Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11350 89 / 2e-21 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) AT1G11300 82 / 5e-19 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G61610 76 / 5e-17 S-locus lectin protein kinase family protein (.1) AT1G11330 76 / 7e-17 S-locus lectin protein kinase family protein (.1.2) AT4G27290 75 / 2e-16 S-locus lectin protein kinase family protein (.1) AT1G67520 74 / 3e-16 lectin protein kinase family protein (.1) AT3G16030 74 / 4e-16 CES101 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) AT4G21390 72 / 2e-15 B120 S-locus lectin protein kinase family protein (.1) AT1G11340 66 / 2e-13 S-locus lectin protein kinase family protein (.1) AT1G61380 65 / 5e-13 SD1-29 S-domain-1 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G038100 [exp] 119 / 2e-34 AT1G11300 175 / 2e-50 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Potri.011G039000 [exp] 120 / 2e-32 AT1G11330 797 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039100 [exp] 117 / 3e-31 AT1G11330 859 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G038401 [exp] 115 / 6e-31 AT1G11330 826 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039200 [exp] 115 / 9e-31 AT1G11330 864 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G038300 [exp] 113 / 1e-30 AT1G11330 330 / 1e-105 S-locus lectin protein kinase family protein (.1.2) Potri.011G038000 [exp] 114 / 3e-30 AT1G11330 810 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G037800 [exp] 114 / 3e-30 AT1G11330 838 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G037900 [exp] 112 / 2e-29 AT1G11330 630 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033743 [exp] 74 / 3e-16 AT4G21380 608 / 0.0 receptor kinase 3 (.1) Lus10037865 [exp] 74 / 6e-16 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10025891 [exp] 73 / 7e-16 AT4G21380 593 / 0.0 receptor kinase 3 (.1) Lus10038557 [exp] 72 / 1e-15 AT4G27290 803 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10020052 [exp] 71 / 4e-15 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014723 [exp] 69 / 2e-14 AT1G11340 255 / 7e-79 S-locus lectin protein kinase family protein (.1) Lus10038554 [exp] 69 / 3e-14 AT4G27290 776 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006742 [exp] 68 / 6e-14 AT4G21390 800 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10031603 [exp] 67 / 1e-13 AT4G03230 558 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10003099 [exp] 66 / 3e-13 AT5G18470 296 / 4e-97 Curculin-like (mannose-binding) lectin family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G038901.1 pacid=42781146 polypeptide=Potri.011G038901.1.p locus=Potri.011G038901 ID=Potri.011G038901.1.v4.1 annot-version=v4.1 ATGCTGCTGTCATCACACAACAGGATTTTAGGAATAACAACGCTTATCTTTGTCAACAAAAGAAGAAGTTACAGCCATGCAATCTGCAACGGTTATGATG CTGCAACAGATACAATAACATCATCTCAACCCATCAAAGATCCTGAAACTGTCTCCGCAGGCAATATCTTTGAAATGGGATTTTTCAGCCCTGTTAATTT GACAAATCGCTATGTTGGAATATGGTACAATAATGTTTCTGCAACGAAACCAGAATGGGTTCCCAACGGAAACAACCCAATCGCTGATTCTTCAGGTGCG GTGACGATATCTGAAGATGGAAATCTTGTAGTTTTGAAAGGCCATATAAAGAGATTCTTTGGTCATCAAATGTTTCAAATAGAGTCAGAAACTCCATTGC ACAGGTTTTAG
AA sequence Show only first row Show all	>Potri.011G038901.1 pacid=42781146 polypeptide=Potri.011G038901.1.p locus=Potri.011G038901 ID=Potri.011G038901.1.v4.1 annot-version=v4.1 MLLSSHNRILGITTLIFVNKRRSYSHAICNGYDAATDTITSSQPIKDPETVSAGNIFEMGFFSPVNLTNRYVGIWYNNVSATKPEWVPNGNNPIADSSGA VTISEDGNLVVLKGHIKRFFGHQMFQIESETPLHRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11350		SD1-13, RKS2, C...	CALMODULIN-BINDING RECEPTOR-LI...		Potri.011G038901 [exp]	0	1
AT1G06225		CLE3	CLAVATA3/ESR-RELATED 3 (.1)		Potri.004G053700 [exp]	4.00	0.8481
AT5G20230		SAG14, ATBCB	SENESCENCE ASSOCIATED GENE 14,...		Potri.018G129400 [exp]	10.53	0.8674
					Potri.018G112701 [exp]	15.49	0.7980
					Potri.016G107750 [exp]	17.54	0.7782
					Potri.016G102401 [exp]	22.58	0.6673
AT1G70890		MLP43	MLP-like protein 43 (.1)		Potri.008G131100 [exp]	23.02	0.8223	MLP.2
AT1G78290		SRK2C, SNRK2-8,...	SNF1-RELATED PROTEIN KINASE 2C...		Potri.005G072600 [exp]	23.87	0.8271
AT1G70830		MLP28	MLP-like protein 28 (.1.2.3.4....		Potri.010G111000 [exp]	24.24	0.8252	MLP43.1
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Potri.007G114375 [exp]	37.30	0.8177
AT4G08780			Peroxidase superfamily protein...		Potri.003G214900 [exp]	40.00	0.7949

Compare expression of checked genes

Potri.011G038901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.