Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27310 106 / 2e-28 CO B-box type zinc finger family protein (.1) AT5G54470 99 / 5e-26 CO B-box type zinc finger family protein (.1) AT3G21890 61 / 3e-12 CO B-box type zinc finger family protein (.1) AT4G15248 59 / 2e-11 CO B-box type zinc finger family protein (.1) AT3G21150 56 / 9e-10 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) AT4G15250 57 / 1e-09 CO COL11 B-box type zinc finger protein with CCT domain (.1) AT2G47890 54 / 6e-09 CO COL13 B-box type zinc finger protein with CCT domain (.1.2) AT1G68190 52 / 4e-08 CO B-box zinc finger family protein (.1) AT5G48250 50 / 2e-07 CO COL10 B-box type zinc finger protein with CCT domain (.1) AT3G02380 50 / 3e-07 CO ATCOL2, COL2 CONSTANS-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G026900 [exp] 133 / 7e-40 AT4G27310 109 / 2e-30 B-box type zinc finger family protein (.1) Potri.004G027000 [exp] 106 / 4e-30 AT4G27310 91 / 5e-24 B-box type zinc finger family protein (.1) Potri.004G027100 [exp] 105 / 1e-29 AT5G54470 97 / 4e-26 B-box type zinc finger family protein (.1) Potri.001G414700 [exp] 105 / 1e-27 AT5G54470 126 / 2e-35 B-box type zinc finger family protein (.1) Potri.013G150500 [exp] 101 / 7e-27 AT4G27310 114 / 1e-31 B-box type zinc finger family protein (.1) Potri.011G125400 [exp] 103 / 1e-26 AT5G54470 120 / 1e-32 B-box type zinc finger family protein (.1) Potri.010G251800 [exp] 74 / 5e-16 AT3G21150 130 / 5e-37 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Potri.008G007000 [exp] 69 / 3e-14 AT3G21150 128 / 3e-36 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Potri.017G039400 [exp] 62 / 1e-12 AT4G15248 100 / 3e-28 B-box type zinc finger family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039727 [exp] 103 / 2e-27 AT5G54470 118 / 1e-32 B-box type zinc finger family protein (.1) Lus10018513 [exp] 103 / 2e-27 AT4G27310 117 / 3e-32 B-box type zinc finger family protein (.1) Lus10033751 [exp] 101 / 7e-27 AT4G27310 114 / 9e-32 B-box type zinc finger family protein (.1) Lus10031593 [exp] 99 / 7e-26 AT4G27310 119 / 2e-33 B-box type zinc finger family protein (.1) Lus10015097 [exp] 67 / 2e-14 AT4G15248 94 / 5e-26 B-box type zinc finger family protein (.1) Lus10031583 [exp] 66 / 6e-14 AT3G21890 96 / 1e-26 B-box type zinc finger family protein (.1) Lus10027151 [exp] 58 / 5e-11 AT4G15248 109 / 7e-32 B-box type zinc finger family protein (.1) Lus10033380 [exp] 60 / 6e-11 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Lus10039694 [exp] 58 / 6e-11 AT4G15248 108 / 1e-31 B-box type zinc finger family protein (.1) Lus10034830 [exp] 57 / 5e-10 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [poplar] [flax] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Potri.011G039700.2 pacid=42781722 polypeptide=Potri.011G039700.2.p locus=Potri.011G039700 ID=Potri.011G039700.2.v4.1 annot-version=v4.1 ATGAAAAGGTGTGAGCTCTGTGATTCTTTAGCAAAAGTATACTGTGAATCAGATCAAGCCAACCTATGTTGGGACTGTGATGCTAATGTTCATAGTGCAA ATTTTCTTGTTGCCAAACATTCAAGATCACTTCTTTGTCATGTTTGTCAATCTCTCACGCCCTGGACGGGAACCGGACACAAGTTAGGCCCTACCCTTTC TGTCTGCAACAACTGCGTAAACAACTCGGTTTGTAGAGAAGAAAGAGGAAGAGAAGATGACGAAGAAGGCGACAATGATGATGGTGATGATGATGATGAT GATGATGATGATGATGATGATGATGATGATGATGATCTTGATAGAGAAGAAGATGGTGATGAAGATGAAGATGAAGAAAATGGTGATGGTGGTAATGATC ATGGGGGTGAAGATGATGAAGAAAATCAAGTAGTTCCATGGTCTTCTACGCCGCCTCCGCCTGTTTCAAGCCCTTCTAATGATAGTGAAGAATGTTCAAG CAGATTTTGTGACAGTGATGGAGGGATATCAAAATCAAGAAGAGCATTTTCTTCGAAACACAGGCGTGGAACTGTGCCTTAG
AA sequence Show only first row Show all	>Potri.011G039700.2 pacid=42781722 polypeptide=Potri.011G039700.2.p locus=Potri.011G039700 ID=Potri.011G039700.2.v4.1 annot-version=v4.1 MKRCELCDSLAKVYCESDQANLCWDCDANVHSANFLVAKHSRSLLCHVCQSLTPWTGTGHKLGPTLSVCNNCVNNSVCREERGREDDEEGDNDDGDDDDD DDDDDDDDDDDDLDREEDGDEDEDEENGDGGNDHGGEDDEENQVVPWSSTPPPPVSSPSNDSEECSSRFCDSDGGISKSRRAFSSKHRRGTVP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27310	CO		B-box type zinc finger family ...		Potri.011G039700 [exp]	0	1
AT4G14860	OFP	ATOFP11	ovate family protein 11 (.1)		Potri.008G153500 [exp]	10.09	0.8415
					Potri.013G066620 [exp]	19.59	0.8195
AT5G11390		WIT1	WPP domain-interacting protein...		Potri.004G111350 [exp]	40.59	0.8122
AT3G01980			NAD(P)-binding Rossmann-fold s...		Potri.017G067332 [exp]	41.43	0.8081
					Potri.008G113800 [exp]	48.21	0.7518
					Potri.016G020750 [exp]	48.40	0.8106
AT5G20940			Glycosyl hydrolase family prot...		Potri.009G154032 [exp]	49.95	0.8103
AT5G66910			Disease resistance protein (CC...		Potri.007G039201 [exp]	50.61	0.8096
					Potri.014G163733 [exp]	52.37	0.8103
AT2G31690			alpha/beta-Hydrolases superfam...		Potri.014G150700 [exp]	56.65	0.8089

Compare expression of checked genes

Potri.011G039700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.