Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G54430 214 / 9e-70 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G27320 209 / 3e-67 ATPHOS34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G21210 135 / 5e-36 zinc ion binding (.1) AT3G03270 65 / 8e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 58 / 3e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G53990 56 / 1e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G58450 49 / 9e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G11930 48 / 1e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 47 / 1e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G125500 [exp] 228 / 2e-74 AT5G54430 237 / 3e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G150200 [exp] 215 / 6e-70 AT1G11360 209 / 1e-67 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.001G409100 [exp] 207 / 5e-67 AT5G54430 226 / 2e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.019G119400 [exp] 206 / 7e-66 AT1G11360 164 / 2e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.013G009800 [exp] 60 / 5e-11 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.004G075375 [exp] 59 / 1e-10 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.006G092700 [exp] 55 / 3e-09 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 54 / 5e-09 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.017G144301 [exp] 48 / 8e-07 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039730 [exp] 244 / 7e-81 AT1G11360 288 / 3e-98 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10031594 [exp] 235 / 1e-77 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10033749 [exp] 223 / 1e-72 AT1G11360 245 / 1e-81 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10037867 [exp] 218 / 2e-68 AT1G11360 244 / 1e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10038561 [exp] 187 / 3e-59 AT1G11360 224 / 7e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10018515 [exp] 90 / 1e-22 AT1G11360 127 / 9e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10022602 [exp] 59 / 1e-10 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10016900 [exp] 60 / 4e-10 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10017207 [exp] 57 / 4e-10 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 57 / 7e-10 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.011G039800.7 pacid=42781847 polypeptide=Potri.011G039800.7.p locus=Potri.011G039800 ID=Potri.011G039800.7.v4.1 annot-version=v4.1 ATGGCATCTTCACCATCACCTAAGAAAAACCCACCAACAGAATCCGCCGTGGTGGTTCAAGTCCAACCCCCTTCCCCACGTTTACATGTCACCACTCCAA CAACTGGTGCTCAAAGAAGAATAGGAATTGCTGTTGATCTCAGTGATGAAAGTGCTTTTGCTGTCAAATGGGCTGTTCAAAACTACTTACGTGCTGGTGA TGCAGTGATCTTAGTCCATGTTAGCCCCACAAATGTTCTTTATGGTGCTGATTGGGGTTCGTTGCCAATTAAAGAGAATTACAATCTAGATGATCAAAAT GAAGAGAATCAGCAAAAGATTGAAGAGGATTTTAATCTGTTTACAAGCACCAAAGCTAATGATATAGCACAGCCTCTTGTTGATGCAAACATACCCTTTA AAATTCATATTGTGAAGGATCATGATATGAAAGAAAGGCTTTGTTTGGAGGTTGAGAGGTTGGGGTTCAGTGCTGTGGTAATGGGGAGTAGAGGGTTTGG TGCTTCAAGGAAGAGTAGTAAAGGGAGGTTAGGGAGTGTTAGTGATTATTGTGTTCATCATTGCGTTTGCCCTGTTATTGTTGTGAGGTTTCCTGATGAG AAAGATGGTGGCGCTGGTGAGGAGTCAGAGAGGGACGGTGGGGCGACGTTGTGTACGGTGATGGAGGAGGAGCAGGAAGAGCACGACATGGATGGTAAAC AATCAGGTTTGAGTTTGTTTGTTGTTTTGTTATGCTTAATTGGCTTATGA
AA sequence Show only first row Show all	>Potri.011G039800.7 pacid=42781847 polypeptide=Potri.011G039800.7.p locus=Potri.011G039800 ID=Potri.011G039800.7.v4.1 annot-version=v4.1 MASSPSPKKNPPTESAVVVQVQPPSPRLHVTTPTTGAQRRIGIAVDLSDESAFAVKWAVQNYLRAGDAVILVHVSPTNVLYGADWGSLPIKENYNLDDQN EENQQKIEEDFNLFTSTKANDIAQPLVDANIPFKIHIVKDHDMKERLCLEVERLGFSAVVMGSRGFGASRKSSKGRLGSVSDYCVHHCVCPVIVVRFPDE KDGGAGEESERDGGATLCTVMEEEQEEHDMDGKQSGLSLFVVLLCLIGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11360			Adenine nucleotide alpha hydro...		Potri.011G039800 [exp]	0	1
AT5G13240			transcription regulators (.1)		Potri.010G115800 [exp]	4.69	0.8241
AT5G20150		ATSPX1	ARABIDOPSIS THALIANA SPX DOMA...		Potri.006G253400 [exp]	5.00	0.7900
AT1G03430		AHP5	histidine-containing phosphotr...		Potri.006G098200 [exp]	9.05	0.8211	Pt-HPT3.2
AT2G33550	Trihelix		Homeodomain-like superfamily p...		Potri.003G163000 [exp]	10.81	0.8132
AT3G11890			Sterile alpha motif (SAM) doma...		Potri.006G198500 [exp]	11.48	0.7806
AT1G54150			E3 Ubiquitin ligase family pro...		Potri.003G065500 [exp]	11.66	0.8100
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Potri.004G062300 [exp]	14.69	0.7900
AT5G04750			F1F0-ATPase inhibitor protein,...		Potri.010G240401 [exp]	14.96	0.7747
AT3G15358			unknown protein		Potri.011G052900 [exp]	17.14	0.7514
AT4G08455			BTB/POZ domain-containing prot...		Potri.002G077000 [exp]	19.89	0.7782

Compare expression of checked genes

Potri.011G039800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.