Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28240 41 / 3e-06 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G147700 [exp] 44 / 2e-07 AT4G28240 63 / 1e-14 Wound-responsive family protein (.1) Potri.019G117800 [exp] 40 / 1e-05 AT4G10265 49 / 5e-09 Wound-responsive family protein (.1) Potri.019G117632 [exp] 35 / 0.0004 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 35 / 0.0005 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 35 / 0.0005 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G116300 [exp] 35 / 0.0005 AT4G28240 / Wound-responsive family protein (.1) Potri.019G117201 [exp] 35 / 0.0008 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117200 [exp] 35 / 0.001 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031617 [exp] 39 / 3e-05 AT4G28240 72 / 4e-18 Wound-responsive family protein (.1) Lus10039758 [exp] 38 / 6e-05 AT4G28240 59 / 5e-13 Wound-responsive family protein (.1) Lus10018421 [exp] 37 / 0.0001 ND 32 / 0.010 Lus10002596 [exp] 37 / 0.0002 ND 32 / 0.007 Lus10018535 [exp] 35 / 0.0006 AT4G28240 69 / 9e-17 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [poplar] [flax] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Potri.011G042000.1 pacid=42781459 polypeptide=Potri.011G042000.1.p locus=Potri.011G042000 ID=Potri.011G042000.1.v4.1 annot-version=v4.1 ATGAGTTATTCTAGCAGGAACTGCATGGAAGCTAGTTTGGCAGGGGTTGAAGGCCAGCCTAGTCATGGTTCTAAATCAAACTCAACGTTTCGATCATGGA GTTCCAGGAAGAAAAGCTATTTCTCTGGTGGTAATGGGGGCCGTGATGGAGAGAGCAAGAGAAAACAGGCTGAAGATTCCTTTCAGAGAGTGATGTACTT GAATTGCTGGACACAAGGTTGCTAG
AA sequence Show only first row Show all	>Potri.011G042000.1 pacid=42781459 polypeptide=Potri.011G042000.1.p locus=Potri.011G042000 ID=Potri.011G042000.1.v4.1 annot-version=v4.1 MSYSSRNCMEASLAGVEGQPSHGSKSNSTFRSWSSRKKSYFSGGNGGRDGESKRKQAEDSFQRVMYLNCWTQGC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28240			Wound-responsive family protei...		Potri.011G042000 [exp]	0	1
					Potri.009G009700 [exp]	6.32	0.7514
					Potri.012G075550 [exp]	10.24	0.7536
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Potri.005G187600 [exp]	13.41	0.7787
AT4G37760		SQE3	squalene epoxidase 3 (.1)		Potri.012G120676 [exp]	14.38	0.8044
AT4G38260			Protein of unknown function (D...		Potri.005G252250 [exp]	16.43	0.7668
AT1G65820			microsomal glutathione s-trans...		Potri.017G140900 [exp]	27.33	0.7413
AT2G44310			Calcium-binding EF-hand family...		Potri.002G218775 [exp]	29.29	0.7378
AT4G34950			Major facilitator superfamily ...		Potri.005G112400 [exp]	36.85	0.7318
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Potri.006G107100 [exp]	40.41	0.7159
AT3G16770	AP2_ERF	RAP2.03, ATEBP,...	RELATED TO AP2 3, ETHYLENE RES...		Potri.002G201600 [exp]	47.62	0.7090

Compare expression of checked genes

Potri.011G042000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.