Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61105 231 / 1e-77 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G52900 199 / 6e-65 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G48770 68 / 4e-13 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G57670 67 / 5e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72920 66 / 6e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72840 66 / 1e-12 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G17615 65 / 2e-12 Disease resistance protein (TIR-NBS class) (.1) AT1G51270 65 / 3e-12 structural molecules;transmembrane receptors;structural molecules (.1.2.3.4) AT1G72940 64 / 5e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 63 / 9e-12 Disease resistance protein (TIR-NBS class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G038200 [exp] 363 / 6e-130 AT1G61105 233 / 1e-78 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.011G123100 [exp] 259 / 4e-89 AT1G52900 229 / 2e-77 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.001G403800 [exp] 251 / 1e-85 AT1G52900 233 / 3e-78 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.005G004500 [exp] 81 / 1e-18 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 82 / 4e-18 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002066 [exp] 81 / 2e-17 AT5G36930 631 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 81 / 2e-17 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 80 / 2e-17 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001971 [exp] 79 / 3e-17 AT5G36930 427 / 3e-130 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011216 [exp] 252 / 7e-86 AT1G61105 228 / 2e-76 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Lus10018470 [exp] 251 / 2e-85 AT1G61105 224 / 5e-75 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Lus10007829 [exp] 85 / 4e-19 AT5G36930 330 / 2e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007823 [exp] 82 / 7e-18 AT1G27170 322 / 3e-92 transmembrane receptors;ATP binding (.1.2) Lus10004747 [exp] 78 / 1e-16 AT5G36930 342 / 3e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10040576 [exp] 77 / 2e-16 AT1G27180 355 / 3e-103 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10012311 [exp] 76 / 6e-16 AT5G36930 354 / 6e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10000423 [exp] 76 / 6e-16 AT1G27180 338 / 5e-95 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10033953 [exp] 74 / 3e-15 AT5G36930 347 / 2e-102 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007821 [exp] 74 / 3e-15 AT5G36930 339 / 4e-98 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.011G046800.2 pacid=42780837 polypeptide=Potri.011G046800.2.p locus=Potri.011G046800 ID=Potri.011G046800.2.v4.1 annot-version=v4.1 ATGCAGCAGCGTTCAGCATCGACAGCCAAGAACTTGGTTCGTAAAATCTGGAACCACCACAACCAAATCCAATCCCTCAGACGACCACCCTGTGATGTCT TCATTAATCATCGTTGCATCGATACCAAGAGGACCATCTCCGGGTTGCTCTTCGATCATCTTTCTAGACTCAGGCTCCATCCATTTTTGGATAGCAAGAA CATGAGACCTGGTGACAAATTATTTGACAGCATTGATCGAGCTATCCATGAATGCAAAGTTGGGATTGCTGTGTTTTCGCCGCGTTATTGCGAGTCATAC TTTTGCCTCCATGAATTGGCTTTGTTAATGGAGACAAAGAAAAGAGTTATACCTATATTTTGTGATGTCAAGCCATCTCAGCTTCATGTTAAGGATAACG GGCGTTGTCCTCCCAAAGAGCTGCAAAGGTTTGCCTATGCTCTTGAAGAGGCAAAGTACACCGTTGGACTTACATTTGACACCCTCGAAGGGGATTGGTC TAAATTCTTGACAACCGCTGCGGAGGCCGTCGTTCATAATTTGATCGAGGTGGATGGAGAAGAAACACACAAGGAGCGTAAATATTTTATGAAGAATTAT TTCTGA
AA sequence Show only first row Show all	>Potri.011G046800.2 pacid=42780837 polypeptide=Potri.011G046800.2.p locus=Potri.011G046800 ID=Potri.011G046800.2.v4.1 annot-version=v4.1 MQQRSASTAKNLVRKIWNHHNQIQSLRRPPCDVFINHRCIDTKRTISGLLFDHLSRLRLHPFLDSKNMRPGDKLFDSIDRAIHECKVGIAVFSPRYCESY FCLHELALLMETKKRVIPIFCDVKPSQLHVKDNGRCPPKELQRFAYALEEAKYTVGLTFDTLEGDWSKFLTTAAEAVVHNLIEVDGEETHKERKYFMKNY F

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61105			Toll-Interleukin-Resistance (T...		Potri.011G046800 [exp]	0	1
AT5G59340	HD	WOX2	WUSCHEL related homeobox 2 (.1...		Potri.001G237900 [exp]	4.89	0.9370	WOX2.1
					Potri.007G013700 [exp]	22.13	0.9446
					Potri.004G221450 [exp]	28.67	0.9409
					Potri.006G260985 [exp]	40.62	0.9390
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.008G175000 [exp]	47.91	0.9380
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Potri.005G098000 [exp]	51.96	0.9378	NAC077
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.003G010763 [exp]	52.05	0.9372
AT4G39230			NmrA-like negative transcripti...		Potri.011G168400 [exp]	55.29	0.9371
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Potri.010G236800 [exp]	70.56	0.9318
AT3G42880			Leucine-rich repeat protein ki...		Potri.006G139700 [exp]	77.62	0.9324

Compare expression of checked genes

Potri.011G046800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.