Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20710 152 / 8e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G60770 135 / 4e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G02150 128 / 5e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21705 112 / 2e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G01990 100 / 2e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G27460 99 / 1e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G02370 96 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02820 87 / 2e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G28020 86 / 7e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G80270 63 / 3e-11 PPR596 PENTATRICOPEPTIDE REPEAT 596 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G063300 [exp] 212 / 8e-66 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.016G063400 [exp] 188 / 2e-56 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G133000 [exp] 179 / 1e-53 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132500 [exp] 166 / 2e-48 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132700 [exp] 165 / 6e-48 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.018G079600 [exp] 142 / 1e-39 AT1G60770 701 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G042500 [exp] 135 / 8e-37 AT4G21705 608 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.011G120900 [exp] 129 / 1e-34 AT4G21705 483 / 8e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G157400 [exp] 129 / 1e-34 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033698 [exp] 144 / 5e-40 AT2G20710 349 / 4e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10018588 [exp] 143 / 1e-39 AT2G20710 303 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10000091 [exp] 135 / 3e-37 AT4G21705 426 / 8e-147 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005855 [exp] 135 / 7e-37 AT4G21705 503 / 5e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013047 [exp] 133 / 6e-36 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029313 [exp] 130 / 1e-35 AT2G20710 127 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10001213 [exp] 129 / 2e-34 AT4G21705 500 / 2e-174 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003590 [exp] 126 / 2e-33 AT4G21705 434 / 2e-148 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022033 [exp] 122 / 3e-32 AT4G02820 468 / 9e-163 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005600 [exp] 114 / 9e-32 AT2G20710 91 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.011G051700.2 pacid=42780779 polypeptide=Potri.011G051700.2.p locus=Potri.011G051700 ID=Potri.011G051700.2.v4.1 annot-version=v4.1 ATGGAGTCAGATGGGGAGGTGGTTGGAGATTGGAATACTTATTGCGTTGCAGCAGATCGGTGCTTGAAAGCTGGGATAATGGAAATGGCGATGACAATGC TGAAGAAACTTGAGGGACAGATAACTGAAAAAACAAAGAGTATTGCATTTGATACTCTCCTGAAGTTGTATGCCAGAAAAGGAAATAAAGATGAGTTGTA TCGTATCTGGAAATCTGACGAGAAAAGGGATAAAATCTACAATAAGGGCTATATGAGCATGATAAGCTCGCTTTTGATGTTGGATGATATTGAAGCTGCC GAGATGATGTTTAAGGAGTGGGAATCCAGGGGATTATCCTATTATTTCCGAGTTCCTAACATATTGATTAATGCATATTGCAGGAATAATCTTTTAGAGA AGGCTGGATCCCTTATAGATCATGCGATGATGAAAGGGAGTGAACCTTCAGCTGATGCATGGTATTCTCTGGCAAGTGGGTATCTTGAGGTTAATCAAAT CCCCATGGCTAAGGAAGCTATGAAGAAAGCAATCTTGGTGTGTCCGGGATGGAAACCCATCAAGGAAACTTTAGCTTCCTGTTTGGATCATTTGGAAGGG AAGGGAGATCAGAACAAAGCTGAAGAGTTCATAGAATTACTGAGAACTGAGAATGTTTTCTCTCCAGTTGCTCACAACAGATTGCGGACGTATATTAAGG GTCTCAAATCACAATCTGATGGGCTTCTGTAA
AA sequence Show only first row Show all	>Potri.011G051700.2 pacid=42780779 polypeptide=Potri.011G051700.2.p locus=Potri.011G051700 ID=Potri.011G051700.2.v4.1 annot-version=v4.1 MESDGEVVGDWNTYCVAADRCLKAGIMEMAMTMLKKLEGQITEKTKSIAFDTLLKLYARKGNKDELYRIWKSDEKRDKIYNKGYMSMISSLLMLDDIEAA EMMFKEWESRGLSYYFRVPNILINAYCRNNLLEKAGSLIDHAMMKGSEPSADAWYSLASGYLEVNQIPMAKEAMKKAILVCPGWKPIKETLASCLDHLEG KGDQNKAEEFIELLRTENVFSPVAHNRLRTYIKGLKSQSDGLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20710			Tetratricopeptide repeat (TPR)...		Potri.011G051700 [exp]	0	1
					Potri.019G042001 [exp]	10.63	0.8885
					Potri.009G016766 [exp]	16.30	0.8437
AT5G62380	NAC	ANAC101, VND6	VASCULAR-RELATED NAC-DOMAIN 6,...		Potri.006G231300 [exp]	17.14	0.8444
AT2G03360			Glycosyltransferase family 61 ...		Potri.010G162200 [exp]	18.00	0.8379
					Potri.014G188082 [exp]	19.59	0.7955
AT4G33230			Plant invertase/pectin methyle...		Potri.003G021600 [exp]	21.63	0.8687
AT4G30480		TPR1, AtTPR1	tetratricopeptide repeat 1, Te...		Potri.006G178900 [exp]	28.14	0.8249
AT1G48270		GCR1	G-protein-coupled receptor 1 (...		Potri.008G206000 [exp]	31.41	0.7742	GCR1.1
AT1G18760			Zinc finger, C3HC4 type (RING ...		Potri.002G083001 [exp]	31.46	0.8563
					Potri.019G040151 [exp]	37.69	0.8028

Compare expression of checked genes

Potri.011G051700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.