Potri.011G053700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
AT2G33780 126 / 1e-35 VQ motif-containing protein (.1)
AT3G15300 122 / 7e-34 VQ motif-containing protein (.1)
AT5G53830 108 / 5e-28 VQ motif-containing protein (.1)
AT1G80450 46 / 4e-06 VQ motif-containing protein (.1)
AT5G08480 40 / 0.0006 VQ motif-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G044800 281 / 4e-95 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.011G118200 172 / 7e-53 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.001G399100 170 / 4e-52 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.004G134200 62 / 2e-11 AT5G08480 150 / 1e-46 VQ motif-containing protein (.1.2)
Potri.006G266700 47 / 3e-06 AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
Potri.018G016500 47 / 4e-06 AT1G80450 67 / 6e-14 VQ motif-containing protein (.1)
Potri.006G266600 47 / 4e-06 AT1G80450 61 / 6e-12 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015315 171 / 2e-52 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10025443 135 / 2e-39 AT1G28280 154 / 2e-47 VQ motif-containing protein (.1.2)
Lus10041929 105 / 5e-27 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
Lus10005543 105 / 8e-27 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
Lus10042423 68 / 2e-13 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10026247 65 / 2e-12 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10020092 49 / 6e-07 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.011G053700.1 pacid=42781578 polypeptide=Potri.011G053700.1.p locus=Potri.011G053700 ID=Potri.011G053700.1.v4.1 annot-version=v4.1
ATGGAAACCTCACCAAGGCATCATCAAGATAACCAGAACCCACAATCTTTCCTTCCTTCACCAAATAGCCACAGCAGCAGCAGCAGCAACAGTAGCTCCA
CCACGACGACGACAAATAATGTTGCACTCAACAACAATATTAACTACCCACCACCACTTCCGTCACCCAAACCCATTTCCAGATCCGAATCCACTAACCC
ATACCCGACAACTTTTGTACAAGCTGACACTTCTTCCTTCAAACAAGTAGTCCAGATGTTGACTGGATCGCCCAAACCCGCCTCCACCACCACCTCCATC
TCCACCACCCCAACCATCTCACAACCCGACCCTTCTCCTAGAAACCACAACATCCCTCCAATTAAATCCATACCAAAAAAGAACCAATCTTCCGGGTTCA
AACTTTATGAACGTAGAAACTCAATCAAGAACCTCAAGATCAACCCTTTAAATCCGGTATTTGCCAGACCCAGTCCAGGCTTTTCTCCAAGAAAGCCAGA
GATTCTGTCCCCAAGCATTCTCGATTTCCCTTCTCTTATTTTAAGCCCGGTGACTCCTTTAATACCCGACCCGTTTGACCGTTCCGGATCAGCGAAGTAT
ACTAATTGTTTTAGTCCCATGAACAACAACAACAACAACAACAACAACAACAACAACAACTTCGTTAATGCTAATGTGATGGATACTGATGCAGAGGAGA
AAGCAATAAAAGAGAGAGGATTTTACTTGCATCCATCACCCGGATCCACACCAAGAGAGACTGAGCCCCGATTGTTACCTCTATTTCCTGTTACTTCGCC
AAGAGTTTCAGGTTCTGCTAGTCCGTCATCTTGA
AA sequence
>Potri.011G053700.1 pacid=42781578 polypeptide=Potri.011G053700.1.p locus=Potri.011G053700 ID=Potri.011G053700.1.v4.1 annot-version=v4.1
METSPRHHQDNQNPQSFLPSPNSHSSSSSNSSSTTTTTNNVALNNNINYPPPLPSPKPISRSESTNPYPTTFVQADTSSFKQVVQMLTGSPKPASTTTSI
STTPTISQPDPSPRNHNIPPIKSIPKKNQSSGFKLYERRNSIKNLKINPLNPVFARPSPGFSPRKPEILSPSILDFPSLILSPVTPLIPDPFDRSGSAKY
TNCFSPMNNNNNNNNNNNNNFVNANVMDTDAEEKAIKERGFYLHPSPGSTPRETEPRLLPLFPVTSPRVSGSASPSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28280 VQ motif-containing protein (.... Potri.011G053700 0 1
AT5G44210 AP2_ERF AtERF9, ATERF-9 ERF DOMAIN PROTEIN- 9, erf dom... Potri.017G013700 4.12 0.6600 ERF46
AT3G57530 ATCPK32, CDPK32... calcium-dependent protein kina... Potri.006G052900 5.47 0.6076 CPK14.1
AT1G49780 PUB26 plant U-box 26 (.1) Potri.009G100200 14.07 0.6011
AT5G60800 Heavy metal transport/detoxifi... Potri.004G214700 17.74 0.6020
AT4G08850 Leucine-rich repeat receptor-l... Potri.002G258200 18.54 0.6019
AT1G80450 VQ motif-containing protein (.... Potri.006G266600 19.97 0.6227
AT5G63260 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Potri.012G092500 21.44 0.5959
AT4G08850 Leucine-rich repeat receptor-l... Potri.002G258000 22.53 0.6295
AT4G24240 WRKY ATWRKY7, WRKY7 WRKY DNA-binding protein 7 (.1... Potri.002G123300 31.44 0.5671
AT5G11000 Plant protein of unknown funct... Potri.018G021800 33.46 0.5747

Potri.011G053700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.