Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24490 89 / 8e-23 30S ribosomal protein, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G055100 [exp] 169 / 4e-56 AT5G24490 142 / 2e-42 30S ribosomal protein, putative (.1) Potri.012G009001 [exp] 143 / 1e-45 AT5G24490 147 / 3e-44 30S ribosomal protein, putative (.1) Potri.012G026375 [exp] 140 / 3e-43 AT5G24490 204 / 4e-65 30S ribosomal protein, putative (.1) Potri.012G005800 [exp] 124 / 2e-36 AT5G24490 369 / 1e-128 30S ribosomal protein, putative (.1) Potri.015G002200 [exp] 119 / 3e-34 AT5G24490 362 / 3e-126 30S ribosomal protein, putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015569 [exp] 80 / 2e-19 AT5G24490 358 / 2e-124 30S ribosomal protein, putative (.1) Lus10032935 [exp] 76 / 5e-18 AT5G24490 361 / 1e-125 30S ribosomal protein, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF16321 [poplar] [flax] Ribosom_S30AE_C Sigma 54 modulation/S30EA ribosomal protein C terminus
Representative CDS sequence Show only first row Show all	>Potri.011G054700.2 pacid=42781130 polypeptide=Potri.011G054700.2.p locus=Potri.011G054700 ID=Potri.011G054700.2.v4.1 annot-version=v4.1 ATGAAGATTAAGGACAAGGAATCCGATCATGGTAGACACATGAAAGGATTTAATAAGTTTAAGGTTAGGGAGCCAATGTCACAAGTGGTGGAGAATGATG CAGATACAGTTTCACAGCGAAAAGATGACGACAATCTTGATGAGGCTGTTCACACAAAGTACTTTGACATGCCACCTGTGACTGTCGATGAAGCAATTGT GCGGCTGGGAAATGTGGATCATGCCTTCTATGGTTTCAGGCATGCTGAAAGGGCTAGATAG
AA sequence Show only first row Show all	>Potri.011G054700.2 pacid=42781130 polypeptide=Potri.011G054700.2.p locus=Potri.011G054700 ID=Potri.011G054700.2.v4.1 annot-version=v4.1 MKIKDKESDHGRHMKGFNKFKVREPMSQVVENDADTVSQRKDDDNLDEAVHTKYFDMPPVTVDEAIVRLGNVDHAFYGFRHAERAR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24490			30S ribosomal protein, putativ...		Potri.011G054700 [exp]	0	1
AT3G15390		SDE5	silencing defective 5 (.1.2)		Potri.001G401900 [exp]	2.82	0.8435
AT5G58510			unknown protein		Potri.001G280900 [exp]	3.16	0.8702
					Potri.006G250500 [exp]	4.89	0.8204
AT3G53270			Small nuclear RNA activating c...		Potri.004G126760 [exp]	6.24	0.8475
AT5G10530			Concanavalin A-like lectin pro...		Potri.001G262866 [exp]	11.22	0.8169
AT2G01190		PDE331	PIGMENT DEFECTIVE 331, Octicos...		Potri.008G124700 [exp]	12.84	0.8275
AT1G73875			DNAse I-like superfamily prote...		Potri.012G057100 [exp]	13.41	0.7920
AT1G11330			S-locus lectin protein kinase ...		Potri.011G039000 [exp]	14.14	0.7998
					Potri.006G104150 [exp]	15.42	0.7820
AT1G11925			Stigma-specific Stig1 family p...		Potri.004G031000 [exp]	16.73	0.7571

Compare expression of checked genes

Potri.011G054700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.