Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27680 82 / 4e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G53540 80 / 2e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G50140 49 / 1e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT4G24860 47 / 1e-07 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G02480 46 / 1e-07 AAA-type ATPase family protein (.1) AT3G19740 46 / 2e-07 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G02890 45 / 5e-07 AAA-type ATPase family protein (.1.2) AT1G64110 43 / 2e-06 DAA1 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) AT1G62130 41 / 1e-05 AAA-type ATPase family protein (.1) AT4G28000 39 / 6e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G007700 [exp] 87 / 7e-22 AT4G27680 615 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G025351 [exp] 56 / 6e-11 AT4G27680 322 / 5e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G027101 [exp] 52 / 3e-10 AT4G27680 166 / 3e-51 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G017760 [exp] 52 / 3e-10 AT4G27680 164 / 1e-50 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G022985 [exp] 50 / 6e-10 AT5G53540 95 / 7e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G027901 [exp] 50 / 9e-10 AT5G53540 182 / 2e-57 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G069800 [exp] 50 / 6e-09 AT1G50140 1215 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.005G093300 [exp] 47 / 6e-08 AT3G19740 1209 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G096300 [exp] 47 / 1e-07 AT4G02480 1153 / 0.0 AAA-type ATPase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008835 [exp] 84 / 7e-21 AT4G27680 649 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022361 [exp] 83 / 1e-20 AT4G27680 632 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10010204 [exp] 49 / 2e-08 AT3G19740 1242 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10013429 [exp] 49 / 2e-08 AT1G50140 1151 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Lus10017405 [exp] 49 / 3e-08 AT3G19740 1223 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10040976 [exp] 48 / 4e-08 AT3G19740 472 / 2e-154 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10024692 [exp] 45 / 7e-07 AT1G64110 1176 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10010282 [exp] 45 / 7e-07 AT4G02480 1408 / 0.0 AAA-type ATPase family protein (.1) Lus10036347 [exp] 44 / 9e-07 AT4G02480 1395 / 0.0 AAA-type ATPase family protein (.1) Lus10028752 [exp] 41 / 1e-05 AT1G64110 1165 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G055212.1 pacid=42781179 polypeptide=Potri.011G055212.1.p locus=Potri.011G055212 ID=Potri.011G055212.1.v4.1 annot-version=v4.1 ATGTTAATTAGAATGGATGTCATAGCATGTGATGTTATAAATCCTGATCACATAGATGTGGAATTTGAATTAATTGGAGGATTGGAATCTATCAAGCAAG CTTTGTATGAACTGGTGATTCTTCATCTGCGGAAACCTGAGCTCTTCTCACATGGGAAACTTCTTGGTCTACAAAAGGGGGTATTGTTATATGAACCTCT CTGA
AA sequence Show only first row Show all	>Potri.011G055212.1 pacid=42781179 polypeptide=Potri.011G055212.1.p locus=Potri.011G055212 ID=Potri.011G055212.1.v4.1 annot-version=v4.1 MLIRMDVIACDVINPDHIDVEFELIGGLESIKQALYELVILHLRKPELFSHGKLLGLQKGVLLYEPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27680			P-loop containing nucleoside t...		Potri.011G055212 [exp]	0	1
AT2G47890	CO	COL13	B-box type zinc finger protein...		Potri.014G134601 [exp]	4.00	0.9400
AT1G02260			Divalent ion symporter (.1)		Potri.017G141800 [exp]	5.65	0.9372
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Potri.006G022500 [exp]	6.32	0.9362
AT4G08850			Leucine-rich repeat receptor-l...		Potri.002G008175 [exp]	9.16	0.9368
AT3G52070			unknown protein		Potri.009G059100 [exp]	11.22	0.9325
AT3G50770		CML41	calmodulin-like 41 (.1)		Potri.005G128100 [exp]	11.48	0.9332
AT1G68040			S-adenosyl-L-methionine-depend...		Potri.019G016112 [exp]	17.88	0.9343
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.001G168000 [exp]	19.89	0.9292
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.013G054000 [exp]	24.00	0.9201
AT5G63520			unknown protein		Potri.004G005700 [exp]	24.53	0.9252

Compare expression of checked genes

Potri.011G055212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.