Potri.011G057200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06760 110 / 1e-29 Drought-responsive family protein (.1.2)
AT3G05700 108 / 8e-29 Drought-responsive family protein (.1)
AT5G49230 105 / 1e-27 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
AT5G26990 99 / 3e-25 Drought-responsive family protein (.1)
AT1G56280 89 / 2e-21 ATDI19 drought-induced 19 (.1.2)
AT4G02200 75 / 2e-16 Drought-responsive family protein (.1.2.3)
AT1G02750 69 / 7e-14 Drought-responsive family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G020900 134 / 6e-39 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1)
Potri.013G011200 132 / 4e-38 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1)
Potri.008G213400 117 / 2e-32 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.010G000800 116 / 5e-32 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.014G125500 87 / 1e-20 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1)
Potri.002G200500 87 / 2e-20 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1)
Potri.012G086500 82 / 8e-19 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
Potri.019G027300 75 / 2e-17 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015412 258 / 2e-87 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1)
Lus10013990 189 / 2e-60 AT5G26990 78 / 1e-17 Drought-responsive family protein (.1)
Lus10031467 120 / 2e-33 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1)
Lus10037819 114 / 4e-31 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10001462 93 / 9e-23 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1)
Lus10002441 81 / 1e-19 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1)
Lus10013420 84 / 2e-19 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2)
Lus10010305 75 / 4e-16 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2)
Lus10017956 76 / 7e-16 AT5G26990 74 / 8e-15 Drought-responsive family protein (.1)
Lus10015214 69 / 5e-14 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF05605 zf-Di19 Drought induced 19 protein (Di19), zinc-binding
CL0361 PF14571 Di19_C Stress-induced protein Di19, C-terminal
Representative CDS sequence
>Potri.011G057200.2 pacid=42780321 polypeptide=Potri.011G057200.2.p locus=Potri.011G057200 ID=Potri.011G057200.2.v4.1 annot-version=v4.1
ATGACCTCTAATTTTTGGACATCTCGCATCGCCGCCGCTAAACAGCAGTATGCGTCACAGCACCATCATCAGAGTTCCCATCAAGATCGTTTCAATATTG
ATGATTTCGAGGTAGAAGAAGAGGTTAGACCTGATTTTCCATGTCCTTACTGTTATGAAGATTTCGATATCGGGTCTCTGTGTTCGCATCTTGAAGATGA
GCACTCGTACGAGTCTAAAGTCGCCGTTTGTCCTATTTGCTCTGTTAAAGTTGCTCAGGACATGCTAAGTCATATTACATTACAACATGGACACTTGTTC
AAGTTGCAGAGACGTCGCAGGTTACGTAGAGTTGCAATTCCTAACAGTCAGGCATTGTCTCTCCTTGGTCGTGATCTCCGTGAGGCTCATCTGCAAGTGC
TGTTAGGGGGTGGTGGATATAGGTCAAATAACACTAATGCTAATGTGTCCAATGCCTCCACCGATCCATTCCTTTCATCTTTCATTTTAAATTTCCATAC
ATCTGAAGCAGAGGAAATTTCAAAATCTGTGGTAACGAGTATAGAGGATTCTTCTGCAAAGAATTCAGCACCATCTCATATGTGGAAATCAAGTTTTGAT
CCTTCTTTGAGTTACGAAGAGAGGGAAAAAAGGATGAAGCAAGTTTCTGGGAGAGTTGGTTTTGTGCAGGATTTGCTTCTCTCAACCTTGTTAAGCAACT
AA
AA sequence
>Potri.011G057200.2 pacid=42780321 polypeptide=Potri.011G057200.2.p locus=Potri.011G057200 ID=Potri.011G057200.2.v4.1 annot-version=v4.1
MTSNFWTSRIAAAKQQYASQHHHQSSHQDRFNIDDFEVEEEVRPDFPCPYCYEDFDIGSLCSHLEDEHSYESKVAVCPICSVKVAQDMLSHITLQHGHLF
KLQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGGGGYRSNNTNANVSNASTDPFLSSFILNFHTSEAEEISKSVVTSIEDSSAKNSAPSHMWKSSFD
PSLSYEEREKRMKQVSGRVGFVQDLLLSTLLSN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G06760 Drought-responsive family prot... Potri.011G057200 0 1
AT1G03905 ABCI19 ATP-binding cassette I19, P-lo... Potri.002G036300 1.00 0.8274 POP.2
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Potri.001G113900 2.64 0.7318
AT1G17720 ATBBETA, ATB BE... Protein phosphatase 2A, regula... Potri.001G197300 2.82 0.7303 Pt-ATB.1
AT2G29900 PS2 Presenilin-2 (.1) Potri.015G058301 3.16 0.7479
AT4G14240 CBS domain-containing protein ... Potri.010G030200 3.46 0.7215
AT3G20970 ATNFU2, NFU4 ARABIDOPSIS THALIANA NFU DOMAI... Potri.010G237400 5.29 0.7814 NFU4.2
AT1G68140 Protein of unknown function (D... Potri.003G021800 7.34 0.7030
AT1G02130 ARA5, AtRABD2a,... ARABIDOPSIS THALIANA RAB D2A, ... Potri.003G081800 7.74 0.7322 RAB1.6
AT1G52280 AtRABG3d RAB GTPase homolog G3D (.1) Potri.003G053400 8.48 0.7713
AT2G36350 Protein kinase superfamily pro... Potri.009G146700 9.59 0.6908

Potri.011G057200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.