Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28395 104 / 1e-30 unknown protein AT2G33847 102 / 5e-30 unknown protein AT2G20585 66 / 2e-15 NFD6 nuclear fusion defective 6 (.1.2.3) AT1G55205 44 / 4e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G048100 [exp] 103 / 1e-30 AT1G28395 91 / 1e-25 unknown protein Potri.017G014500 [exp] 66 / 3e-15 AT2G20585 72 / 5e-18 nuclear fusion defective 6 (.1.2.3) Potri.007G137500 [exp] 63 / 3e-14 AT2G20585 66 / 1e-15 nuclear fusion defective 6 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002171 [exp] 74 / 1e-18 AT2G20585 81 / 2e-21 nuclear fusion defective 6 (.1.2.3) Lus10039888 [exp] 72 / 1e-17 AT2G20585 77 / 2e-19 nuclear fusion defective 6 (.1.2.3) Lus10032319 [exp] 40 / 0.0001 AT1G55205 75 / 5e-18 unknown protein Lus10023655 [exp] 37 / 0.0003 AT1G55205 83 / 3e-22 unknown protein Lus10024700 [exp] 37 / 0.0009 AT1G55205 80 / 4e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G057300.2 pacid=42780613 polypeptide=Potri.011G057300.2.p locus=Potri.011G057300 ID=Potri.011G057300.2.v4.1 annot-version=v4.1 ATGTCCGCCACCGCAGCTGCCAGGTCTTTCCTCCGTTCTACAGCCACCAGAACCTCTGCGGCTGCCAGACTAGCGTCCGCACCCAAACCTGGATCCAAAC CAGCTTCTTCGCCATTTCGCATCTCCAAAGAAAGCCCTCTCTCTCATCGTATTTTCAGGTCGCCAGTGGAGATGAGTTGCTGTGTAGAGACAATGCTTCC ATACCACACTGCCACTGCCTCCGCATTGCTTAATTCAATGCTCTCCGTCTCTCGCCGCTATGGTTGGACCCCTGAAGATTGCAATGACGATCTATGA
AA sequence Show only first row Show all	>Potri.011G057300.2 pacid=42780613 polypeptide=Potri.011G057300.2.p locus=Potri.011G057300 ID=Potri.011G057300.2.v4.1 annot-version=v4.1 MSATAAARSFLRSTATRTSAAARLASAPKPGSKPASSPFRISKESPLSHRIFRSPVEMSCCVETMLPYHTATASALLNSMLSVSRRYGWTPEDCNDDL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G28395			unknown protein		Potri.011G057300 [exp]	0	1
AT5G47455			unknown protein		Potri.001G333800 [exp]	2.23	0.8856
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Potri.017G100800 [exp]	3.74	0.9066
AT1G47278			unknown protein		Potri.009G029400 [exp]	4.47	0.8301
AT2G27530		PGY1	PIGGYBACK1, Ribosomal protein ...		Potri.007G035600 [exp]	5.83	0.8981
AT3G62120			Class II aaRS and biotin synth...		Potri.014G112400 [exp]	7.34	0.8370
AT3G25545			unknown protein		Potri.010G134600 [exp]	7.34	0.8241
AT2G40010			Ribosomal protein L10 family p...		Potri.008G066300 [exp]	7.74	0.8953
AT3G20050		ATTCP-1	T-complex protein 1 alpha subu...		Potri.014G058500 [exp]	8.36	0.8625	BSTCP.1
AT3G03960			TCP-1/cpn60 chaperonin family ...		Potri.013G058500 [exp]	8.48	0.8592
AT2G39990		AteIF3f, EIF2	Arabidopsis thaliana eukaryoti...		Potri.010G192000 [exp]	9.38	0.8620	Pt-TIF3.4

Compare expression of checked genes

Potri.011G057300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.