Plant FIBer expression Database

SYP61.2 (Potri.011G059700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol SYP61.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28490 311 / 7e-108 OSM1, ATSYP61, SYP61 syntaxin of plants 61 (.1.2)
AT1G27700 53 / 4e-08 Syntaxin/t-SNARE family protein (.1)
AT4G30240 42 / 0.0001 Syntaxin/t-SNARE family protein (.1)
AT1G16240 42 / 0.0002 ATSYP51, SYP51 syntaxin of plants 51 (.1.2.3)
AT1G79590 42 / 0.0002 ATSYP52, SYP52 syntaxin of plants 52 (.1.2)
AT2G18860 40 / 0.0008 Syntaxin/t-SNARE family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G050800
[exp]
384 / 8e-137 AT1G28490 297 / 2e-102 syntaxin of plants 61 (.1.2)
Potri.014G019100
[exp]
46 / 1e-05 AT1G27700 276 / 1e-91 Syntaxin/t-SNARE family protein (.1)
Potri.016G030100
[exp]
41 / 0.0003 AT1G79590 265 / 3e-90 syntaxin of plants 52 (.1.2)
Potri.006G032800
[exp]
41 / 0.0004 AT1G79590 238 / 2e-79 syntaxin of plants 52 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018642
[exp]
308 / 1e-106 AT1G28490 334 / 7e-117 syntaxin of plants 61 (.1.2)
Lus10039880
[exp]
305 / 2e-104 AT1G28490 271 / 4e-91 syntaxin of plants 61 (.1.2)
Lus10017686
[exp]
276 / 8e-94 AT1G28490 299 / 8e-103 syntaxin of plants 61 (.1.2)
Lus10007766
[exp]
50 / 6e-07 AT1G27700 292 / 2e-98 Syntaxin/t-SNARE family protein (.1)
Lus10018703
[exp]
49 / 2e-06 AT1G27700 290 / 2e-97 Syntaxin/t-SNARE family protein (.1)
Lus10002446
[exp]
41 / 0.0005 AT1G16240 265 / 2e-90 syntaxin of plants 51 (.1.2.3)
Lus10016577
[exp]
41 / 0.0005 AT1G79590 319 / 1e-111 syntaxin of plants 52 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
PF09177 Syntaxin-6_N Syntaxin 6, N-terminal
Representative CDS sequence
>Potri.011G059700.3 pacid=42781559 polypeptide=Potri.011G059700.3.p locus=Potri.011G059700 ID=Potri.011G059700.3.v4.1 annot-version=v4.1
ATGTCATCAGCGCAAGACCCGTTTTATATTGTGAAAGAGGAGATTCAAGAATCTATTGACAAGTTGCAATCTTCTTTTCACCAATGGGAACGGATTTCTT
GTGATATGGGAGACCAAGTGCATCTTACAAAGGACCTGCTTGCTGCTTGTGAGAGCATTGAGTGGAAGGTGGATGAATTGGACAAAGCAATTTCTGTAGC
AGGTAGAGATCCTTCTTGGTATGGCATTGATGAAGCAGAGCTCGAAAAACGGAGGAGATGGACCAGCACTGCTCGCAATCAGGTGGGCAATGTGAAGAAA
GCAGTAGTAGCCGGAAGAGAGGTGAATATTAGTGGAACTGCTAGTGTGAGTGGGATGCGCAGAGAATTAATGAGGATGCCTAATTCTCAACAGGCTGACA
AATCCAACCAGTATACTCAAGATAATGATGATTTTATACAATCAGAATCAGATAGACAATTGCTTCTTATAAAGCAACAGGATGAGGAGTTGGATGAGCT
CAGTATAACCATCGGGAGACTTGGAGGTGTTGGCCTTACCATACATGAAGAGCTCCTTGCACAGGAAAAGATCATAGATGATTTGGGTATGGAAATGGAC
AGTACATCGAATCGACTTGACTTTGTTCAGAAAAAAGTTGCCATGGTCATGAAGAAGGCCAGTGCAAAGGGGCAACTTATGATGATATTGTTTTTGGTAG
TTTTGTTCATCATCTTATTTGTTCTGGTCTTTCTGACCTAA
AA sequence
>Potri.011G059700.3 pacid=42781559 polypeptide=Potri.011G059700.3.p locus=Potri.011G059700 ID=Potri.011G059700.3.v4.1 annot-version=v4.1
MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISCDMGDQVHLTKDLLAACESIEWKVDELDKAISVAGRDPSWYGIDEAELEKRRRWTSTARNQVGNVKK
AVVAGREVNISGTASVSGMRRELMRMPNSQQADKSNQYTQDNDDFIQSESDRQLLLIKQQDEELDELSITIGRLGGVGLTIHEELLAQEKIIDDLGMEMD
STSNRLDFVQKKVAMVMKKASAKGQLMMILFLVVLFIILFVLVFLT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28490 OSM1, ATSYP61, ... syntaxin of plants 61 (.1.2) Potri.011G059700
[exp]
0 1 SYP61.2
AT3G03800 ATSYP131, SYP13... syntaxin of plants 131 (.1) Potri.019G036700
[exp]
3.74 0.9131 SYP131.2
AT2G35658 unknown protein Potri.003G081900
[exp]
4.24 0.8878
AT1G17280 UBC34 ubiquitin-conjugating enzyme 3... Potri.003G073100
[exp]
8.48 0.9052
Potri.001G466500
[exp]
12.36 0.9047
AT1G10650 SBP (S-ribonuclease binding pr... Potri.010G042200
[exp]
12.64 0.8967
AT1G35720 ATOXY5, ANNAT1 annexin 1 (.1) Potri.002G095600
[exp]
13.85 0.8995 ANNAT1.1
AT5G02440 unknown protein Potri.009G030100
[exp]
14.42 0.8901
AT5G50840 unknown protein Potri.010G219700
[exp]
17.88 0.8630
AT1G27170 transmembrane receptors;ATP bi... Potri.012G053200
[exp]
18.33 0.8920
AT2G32580 Protein of unknown function (D... Potri.014G155600
[exp]
20.12 0.9007

Potri.011G059700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.