Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RAB11.12
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60860 416 / 4e-150 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 408 / 6e-147 AtRABA1g RAB GTPase homolog A1G (.1) AT2G33870 394 / 1e-141 ArRABA1h RAB GTPase homolog A1H (.1) AT1G28550 393 / 3e-141 AtRABA1i RAB GTPase homolog A1I (.1) AT4G18430 383 / 4e-137 AtRABA1e RAB GTPase homolog A1E (.1) AT4G18800 362 / 5e-129 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G45750 355 / 4e-126 AtRABA1c RAB GTPase homolog A1C (.1) AT1G16920 340 / 3e-120 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT1G06400 337 / 3e-119 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G09630 309 / 6e-108 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G123600 [exp] 406 / 3e-146 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 406 / 3e-146 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.001G374000 [exp] 400 / 4e-144 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.011G070300 [exp] 353 / 3e-125 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 351 / 2e-124 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.003G004100 [exp] 306 / 1e-106 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.008G061300 [exp] 302 / 2e-105 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 300 / 2e-104 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 299 / 4e-104 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002178 [exp] 413 / 3e-149 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 412 / 2e-148 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10017679 [exp] 409 / 1e-147 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 409 / 2e-147 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10013961 [exp] 406 / 4e-146 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1) Lus10039895 [exp] 384 / 1e-137 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1) Lus10029253 [exp] 359 / 8e-128 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 356 / 2e-126 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10020746 [exp] 327 / 3e-115 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029789 [exp] 327 / 4e-115 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.011G061300.1 pacid=42782076 polypeptide=Potri.011G061300.1.p locus=Potri.011G061300 ID=Potri.011G061300.1.v4.1 annot-version=v4.1 ATGGGAGCCTATAGAGCTGACGATGATTACGATTACTTGTTTAAGGTGGTATTGATCGGTGATTCAGGCGTTGGCAAATCCAATCTCTTGTCTCGTTTTA CAAGAAATGAATTCAGTCTCGAATCCAAATCCACCATTGGCGTCGAGTTTGCTACTCGCAGCATTCGCGTTGATGATAAAATCGTTAAGGCCCAGATTTG GGACACTGCTGGCCAAGAAAGATACCGTGCTATAACAAGTGCATACTATCGAGGAGCTGTTGGAGCCTTACTAGTCTATGATGTAACCCGCCATGTTACA TTCGAGAATGTGGAGAGATGGCTAAAGGAGCTTCGCGATCACACAGATGCTAACAATGTGATCATGCTTGTAGGAAATAAAGCAGACCTGCGTCACCTCC GAGCAGTTGCCACTGAGGATGCCAAGGGTTTTGCTGAAAGAGAGAGCACATTTTTCATGGAGACTTCTGCTCTCGAGTCAATGAATGTTGAAAATGCTTT CACAGAAGTGCTGACCCAGATCTACCGTGTTGTAAGCAGGAAGGCTCTTGACGTTGGAGATGACTCAACATACTTGCCCAAAGGACAGACGATTAACGTC GGAAGCAGAGATGATGTCTCGGCTGTGAAAAAGGCTGGATGTTGCTCGTCATGA
AA sequence Show only first row Show all	>Potri.011G061300.1 pacid=42782076 polypeptide=Potri.011G061300.1.p locus=Potri.011G061300 ID=Potri.011G061300.1.v4.1 annot-version=v4.1 MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIRVDDKIVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVT FENVERWLKELRDHTDANNVIMLVGNKADLRHLRAVATEDAKGFAERESTFFMETSALESMNVENAFTEVLTQIYRVVSRKALDVGDDSTYLPKGQTINV GSRDDVSAVKKAGCCSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.011G061300 [exp]	0	1	Pt-RAB11.12
AT3G56750			unknown protein		Potri.006G040400 [exp]	1.73	0.9253
AT1G76070			unknown protein		Potri.005G245600 [exp]	2.44	0.8992
AT3G56640		SEC15A	exocyst complex component sec1...		Potri.016G032100 [exp]	3.74	0.8708
AT5G19630			alpha/beta-Hydrolases superfam...		Potri.003G212400 [exp]	4.47	0.8527
AT3G59500			Integral membrane HRF1 family ...		Potri.014G175900 [exp]	5.91	0.8767
AT5G18410		ATSRA1, KLK, PI...	PIROGI 121, PIROGI, KLUNKER, t...		Potri.019G025200 [exp]	6.48	0.8717
AT1G31300			TRAM, LAG1 and CLN8 (TLC) lipi...		Potri.012G118100 [exp]	7.07	0.8608
AT1G69430			unknown protein		Potri.006G159000 [exp]	9.38	0.8792
AT2G45340			Leucine-rich repeat protein ki...		Potri.014G068700 [exp]	9.94	0.8632
AT2G34060			Peroxidase superfamily protein...		Potri.011G062300 [exp]	15.96	0.8563

Compare expression of checked genes

Potri.011G061300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.