Potri.011G064800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29070 106 / 8e-30 Ribosomal protein L34 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013928 100 / 3e-27 AT1G29070 113 / 2e-32 Ribosomal protein L34 (.1)
Lus10000989 91 / 6e-22 AT2G34090 231 / 6e-71 maternal effect embryo arrest 18 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00468 Ribosomal_L34 Ribosomal protein L34
Representative CDS sequence
>Potri.011G064800.2 pacid=42780916 polypeptide=Potri.011G064800.2.p locus=Potri.011G064800 ID=Potri.011G064800.2.v4.1 annot-version=v4.1
ATGGCTACTTCAATATCATTGATATCGTCATCACCGCCACCTTGGATGGCGTCGAGTCGAACAAGAAGCGATGGCAGCGCATCAGCTTCACTCTCTCTTA
TTTCTGGTTCAAGAACGAAAAGGGGTTTTTCAATGAATGTGGCCACCAACTCCACAACTCGCTCAGGGCTGCTTCATTGCTCCTTCCTTCCTTCCTCTTC
TCTCTCTCTACCTTCTTCCTTCTCAGGTTTATCTCTGGGATTGGATTTGAATTCTAACATCGGAGTAAGAAAGGATATAGGTCGTGGTCTAGTGGTGAGA
GCTGGGAAGGCTGCACTTTGTCTAACCAAGAGAAGCAGGTCCAGAAAGTCTCTGGCTCGGACTCATGGCTTCCGTCGAAGAATGAGAACCACTAGTGGGA
GGGCAGTGTTGAAACGTCGACGTGCTAAAGGAAGAAAGGTCCTTTGCACCAAGTCCAATCCCAATAGTGGGAAAGGTTCATAA
AA sequence
>Potri.011G064800.2 pacid=42780916 polypeptide=Potri.011G064800.2.p locus=Potri.011G064800 ID=Potri.011G064800.2.v4.1 annot-version=v4.1
MATSISLISSSPPPWMASSRTRSDGSASASLSLISGSRTKRGFSMNVATNSTTRSGLLHCSFLPSSSLSLPSSFSGLSLGLDLNSNIGVRKDIGRGLVVR
AGKAALCLTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGKGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G29070 Ribosomal protein L34 (.1) Potri.011G064800 0 1
AT4G01310 Ribosomal L5P family protein (... Potri.002G154600 2.00 0.9837
AT3G26650 GAPA-1, GAPA GLYCERALDEHYDE 3-PHOSPHATE DEH... Potri.002G220566 2.64 0.9841
AT5G40950 RPL27 ribosomal protein large subuni... Potri.001G329500 3.74 0.9841 Pt-RPL27.5
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Potri.006G246500 4.47 0.9753
AT3G14930 HEME1 Uroporphyrinogen decarboxylase... Potri.001G390800 5.74 0.9747
AT1G50900 LTD, GDC1 LHCP translocation defect, Gra... Potri.001G420900 6.24 0.9737
AT3G47070 unknown protein Potri.009G043600 6.70 0.9764
AT1G32470 Single hybrid motif superfamil... Potri.003G089300 7.00 0.9770 gdcH3,Pt-GDCH.3
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Potri.009G163200 7.34 0.9788
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Potri.018G068300 7.74 0.9723

Potri.011G064800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.