Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73177 63 / 3e-15 APC13, BNS anaphase-promoting complex 13, bonsai (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G058400 [exp] 89 / 1e-25 AT1G73177 64 / 1e-15 anaphase-promoting complex 13, bonsai (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007286 [exp] 77 / 1e-20 AT1G73177 61 / 2e-14 anaphase-promoting complex 13, bonsai (.1) Lus10029234 [exp] 76 / 2e-20 AT1G73177 61 / 2e-14 anaphase-promoting complex 13, bonsai (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G067800.3 pacid=42781443 polypeptide=Potri.011G067800.3.p locus=Potri.011G067800 ID=Potri.011G067800.3.v4.1 annot-version=v4.1 ATGGCAGAACTAAACATGGGTATTCTTATAGATATTGTGGACGAGGAATGGATGAGAGACACTTTGCCTGATGATGATCTTGCTTTACCACCAGTGATGG TTGTGAGGACTGATGATGCTGAAGATTCAAATCAGGATACTCAACATGTTGATGCAGATGCTTGGCATGATTTGGCCTTAGGCAATCAGTAA
AA sequence Show only first row Show all	>Potri.011G067800.3 pacid=42781443 polypeptide=Potri.011G067800.3.p locus=Potri.011G067800 ID=Potri.011G067800.3.v4.1 annot-version=v4.1 MAELNMGILIDIVDEEWMRDTLPDDDLALPPVMVVRTDDAEDSNQDTQHVDADAWHDLALGNQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Potri.011G067800 [exp]	0	1
AT1G77350			unknown protein		Potri.019G066600 [exp]	1.73	0.9336
AT1G60660		B5 #5, B5#5, AT...	ARABIDOPSIS CYTOCHROME B5-LIKE...		Potri.018G087600 [exp]	4.89	0.8936	B5.1
AT1G47420		SDH5	succinate dehydrogenase 5 (.1)		Potri.014G032400 [exp]	5.29	0.8958
AT5G07960			unknown protein		Potri.015G056300 [exp]	7.93	0.8885
AT5G18800			Cox19-like CHCH family protein...		Potri.010G026000 [exp]	11.31	0.8748
AT1G67250			Proteasome maturation factor U...		Potri.017G111900 [exp]	12.24	0.8578
AT1G49410		TOM6	translocase of the outer mitoc...		Potri.009G110100 [exp]	12.48	0.8388
AT5G47890			NADH-ubiquinone oxidoreductase...		Potri.001G071900 [exp]	12.96	0.8833
AT1G51650			ATP synthase epsilon chain, mi...		Potri.010G250000 [exp]	13.22	0.8915
AT5G51830			pfkB-like carbohydrate kinase ...		Potri.012G132700 [exp]	14.14	0.8460

Compare expression of checked genes

Potri.011G067800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.