Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53440 222 / 1e-67 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53430 219 / 1e-66 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53420 215 / 3e-65 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29750 215 / 5e-65 RKF1 receptor-like kinase in flowers 1 (.1.2) AT1G29740 209 / 8e-63 Leucine-rich repeat transmembrane protein kinase (.1) AT3G14840 208 / 9e-63 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G07650 207 / 3e-62 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G29730 201 / 3e-60 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 194 / 1e-57 Leucine-rich repeat transmembrane protein kinase (.1) AT1G56140 174 / 2e-50 Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G072691 [exp] 327 / 1e-112 AT1G29750 514 / 2e-174 receptor-like kinase in flowers 1 (.1.2) Potri.011G072566 [exp] 325 / 6e-106 AT1G29750 1210 / 0.0 receptor-like kinase in flowers 1 (.1.2) Potri.004G063500 [exp] 289 / 3e-92 AT1G29750 1182 / 0.0 receptor-like kinase in flowers 1 (.1.2) Potri.011G073516 [exp] 233 / 1e-74 AT1G29730 644 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.004G063900 [exp] 228 / 1e-73 AT1G07650 477 / 2e-159 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.004G063600 [exp] 227 / 5e-73 AT1G07650 479 / 4e-160 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G073316 [exp] 225 / 5e-73 AT1G07650 487 / 4e-164 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G073191 [exp] 221 / 1e-72 AT1G07650 370 / 1e-120 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G072841 [exp] 223 / 2e-72 AT1G07650 489 / 3e-165 Leucine-rich repeat transmembrane protein kinase (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005418 [exp] 238 / 1e-74 AT1G29750 800 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10015239 [exp] 236 / 7e-73 AT1G29750 1189 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10041937 [exp] 211 / 8e-64 AT1G53440 1138 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005550 [exp] 210 / 3e-63 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10031374 [exp] 206 / 8e-62 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10031199 [exp] 185 / 2e-54 AT1G56130 1261 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10038153 [exp] 181 / 7e-53 AT1G53440 1046 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10003711 [exp] 157 / 7e-47 AT1G70740 502 / 2e-178 Protein kinase superfamily protein (.1.2) Lus10042460 [exp] 157 / 8e-47 AT1G16670 536 / 0.0 Protein kinase superfamily protein (.1) Lus10026207 [exp] 157 / 2e-46 AT1G16670 541 / 0.0 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.011G072766.1 pacid=42781972 polypeptide=Potri.011G072766.1.p locus=Potri.011G072766 ID=Potri.011G072766.1.v4.1 annot-version=v4.1 ATGACATTTGGACGTGCTCTGTTTCGTCATGAAAACAATCAGCTTAATCTGGATTGGCCTACAAGGCTTAAGATCTGTATTGGGATAGCTAGAGGTCTAG CTTTTCTCCATGAAGAATCAAAACTTAAGATCGCTCACAGAGACATCAAAGCTACAAATGTGCTACTTGATGGGAATCTGAATCCTAAAATATCTGATTT TGGATTGGCTAGGCTTGATGAAGAAGAGAAAAGCCACATCAGCGCCCGAGTTGCTGGAACTATAGGATATATGGCACCAGAATATGCACTATGGGGTTAC TTGACTGACAAAGCAGATGCTTACAGTTTTGGGGTTGTTGCTTTGGAAATTATTAGTGGGAAGAACAACAATAACTACATGCCAAGCAACAGCAGTTGTG TTTGTCTCTTAGATTGGGCCTGCCATTTGCAACAAAGTGGGAGTTTTATAGAGACGTTAGGATCTGAAGTTCACATAGAAGAAGCAGAAACTTGTGTACA AATGCGTCCCCTACACTTAGACCTACAATGTCTGAGGTAG
AA sequence Show only first row Show all	>Potri.011G072766.1 pacid=42781972 polypeptide=Potri.011G072766.1.p locus=Potri.011G072766 ID=Potri.011G072766.1.v4.1 annot-version=v4.1 MTFGRALFRHENNQLNLDWPTRLKICIGIARGLAFLHEESKLKIAHRDIKATNVLLDGNLNPKISDFGLARLDEEEKSHISARVAGTIGYMAPEYALWGY LTDKADAYSFGVVALEIISGKNNNNYMPSNSSCVCLLDWACHLQQSGSFIETLGSEVHIEEAETCVQMRPLHLDLQCLR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53440			Leucine-rich repeat transmembr...		Potri.011G072766 [exp]	0	1
AT2G01818			PLATZ transcription factor fam...		Potri.010G103500 [exp]	5.47	0.8074
AT2G01950		VH1, BRL2	VASCULAR HIGHWAY 1, BRI1-like ...		Potri.008G140500 [exp]	8.94	0.8095
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Potri.002G236200 [exp]	10.67	0.8194	Pt-XTR7.2
AT5G50780			Histidine kinase-, DNA gyrase ...		Potri.012G102800 [exp]	15.87	0.8054
AT2G26590		RPN13	regulatory particle non-ATPase...		Potri.003G027520 [exp]	22.58	0.7950
					Potri.001G443025 [exp]	25.45	0.7771
AT4G37940	MADS	AGL21	AGAMOUS-like 21 (.1)		Potri.009G079000 [exp]	25.90	0.8010
					Potri.004G093250 [exp]	32.00	0.8063
AT1G61010		CPSF73-I	cleavage and polyadenylation s...		Potri.017G076300 [exp]	32.93	0.7790
AT5G18610			Protein kinase superfamily pro...		Potri.008G046500 [exp]	36.00	0.7670	Pt-PNPK2.2

Compare expression of checked genes

Potri.011G072766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.