Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29740 81 / 5e-19 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 79 / 2e-18 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29730 66 / 1e-13 Leucine-rich repeat transmembrane protein kinase (.1) AT1G07650 63 / 6e-13 Leucine-rich repeat transmembrane protein kinase (.1.2) AT3G14840 61 / 4e-12 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G29750 56 / 2e-10 RKF1 receptor-like kinase in flowers 1 (.1.2) AT5G01950 49 / 9e-08 Leucine-rich repeat protein kinase family protein (.1) AT4G13920 48 / 1e-07 AtRLP50 receptor like protein 50 (.1) AT1G53420 47 / 3e-07 Leucine-rich repeat transmembrane protein kinase (.1) AT3G23120 45 / 1e-06 AtRLP38 receptor like protein 38 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G073241 [exp] 167 / 3e-49 AT1G29730 978 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073166 [exp] 140 / 3e-40 AT1G29740 576 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072591 [exp] 137 / 5e-39 AT1G29730 996 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072941 [exp] 137 / 8e-39 AT1G29720 947 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073016 [exp] 133 / 2e-37 AT1G29740 775 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073641 [exp] 120 / 2e-35 AT1G29740 228 / 1e-68 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073041 [exp] 119 / 7e-35 AT1G29740 244 / 2e-74 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072991 [exp] 108 / 8e-29 AT1G29730 488 / 6e-160 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G075400 [exp] 99 / 2e-25 AT1G29740 1012 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015239 [exp] 67 / 4e-14 AT1G29750 1189 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10041937 [exp] 60 / 1e-11 AT1G53440 1138 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10038153 [exp] 60 / 2e-11 AT1G53440 1046 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005550 [exp] 58 / 5e-11 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005418 [exp] 50 / 4e-08 AT1G29750 800 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10013902 [exp] 50 / 5e-08 AT1G49870 454 / 2e-145 unknown protein Lus10006946 [exp] 48 / 8e-08 AT2G34930 195 / 3e-58 disease resistance family protein / LRR family protein (.1) Lus10002117 [exp] 48 / 1e-07 AT3G43740 273 / 9e-94 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10019114 [exp] 48 / 2e-07 AT1G06840 1288 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10034445 [exp] 48 / 3e-07 AT1G06840 1274 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G072816.1 pacid=42781945 polypeptide=Potri.011G072816.1.p locus=Potri.011G072816 ID=Potri.011G072816.1.v4.1 annot-version=v4.1 ATGAATCTGTTGAAACAAGATCCAAAAGCCAATAGCACCATCGTATGCAGTTGCACCCTCATCCTCAATAATGATAGTTATTGTCATATCACGTCATTAT CTCTCAAAACGCTCAATCTTCAAGGCAAGCTCCCGTCTGAAATGGTCAACCTTGCATATTTTGAATTTCTTGACCCAACTCGCAACTACATTTCTGGCAA TATTCCAGAGGAATGGGCTTCAATGAAACATTTGACAAACCTCTCACTTACATCCAATCACTTGTCAGGAAATATTCCTTGGTACTTGGGAAGTTTTCCT AGCCTGACTTACTTTTAA
AA sequence Show only first row Show all	>Potri.011G072816.1 pacid=42781945 polypeptide=Potri.011G072816.1.p locus=Potri.011G072816 ID=Potri.011G072816.1.v4.1 annot-version=v4.1 MNLLKQDPKANSTIVCSCTLILNNDSYCHITSLSLKTLNLQGKLPSEMVNLAYFEFLDPTRNYISGNIPEEWASMKHLTNLSLTSNHLSGNIPWYLGSFP SLTYF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G072816 [exp]	0	1
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Potri.017G096100 [exp]	3.31	0.9308
					Potri.018G088701 [exp]	3.46	0.9148
AT5G40380		CRK42	cysteine-rich RLK (RECEPTOR-li...		Potri.001G348000 [exp]	7.48	0.9102
AT5G61520			Major facilitator superfamily ...		Potri.004G233700 [exp]	8.94	0.8961
AT1G78580		ATTPS1	TREHALOSE-6-PHOSPHATE SYNTHASE...		Potri.011G103900 [exp]	9.89	0.9004
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Potri.014G159800 [exp]	10.95	0.9054
AT4G25960		ABCB2, PGP2	ATP-binding cassette B2, P-gly...		Potri.001G139600 [exp]	12.96	0.8740
AT1G10760		GWD1, GWD, SOP1...	STARCH EXCESS 1, Pyruvate phos...		Potri.010G044100 [exp]	23.51	0.8375
AT1G76520			Auxin efflux carrier family pr...		Potri.001G456300 [exp]	24.37	0.8923
AT5G23980		FRO2, ATFRO4, F...	ferric reduction oxidase 4 (.1...		Potri.017G142800 [exp]	24.97	0.8216	FRO2.1

Compare expression of checked genes

Potri.011G072816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.