Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29740 243 / 3e-74 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29730 224 / 9e-68 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 211 / 8e-63 Leucine-rich repeat transmembrane protein kinase (.1) AT3G14840 200 / 7e-59 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G29750 197 / 5e-58 RKF1 receptor-like kinase in flowers 1 (.1.2) AT1G53440 181 / 3e-52 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53420 179 / 1e-51 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53430 175 / 3e-50 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G07650 175 / 3e-50 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G56140 142 / 2e-38 Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G073641 [exp] 425 / 3e-153 AT1G29740 228 / 1e-68 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073166 [exp] 417 / 2e-143 AT1G29740 576 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073016 [exp] 411 / 1e-137 AT1G29740 775 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072591 [exp] 405 / 2e-135 AT1G29730 996 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072941 [exp] 392 / 2e-130 AT1G29720 947 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073241 [exp] 388 / 1e-128 AT1G29730 978 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073391 [exp] 338 / 4e-111 AT1G29730 893 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072991 [exp] 319 / 8e-105 AT1G29730 488 / 6e-160 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073491 [exp] 290 / 2e-98 AT1G29740 292 / 2e-90 Leucine-rich repeat transmembrane protein kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015239 [exp] 218 / 2e-65 AT1G29750 1189 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10005550 [exp] 188 / 1e-54 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10010951 [exp] 182 / 1e-52 AT1G07650 979 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10041937 [exp] 180 / 6e-52 AT1G53440 1138 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10038153 [exp] 174 / 1e-49 AT1G53440 1046 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10042505 [exp] 165 / 1e-46 AT1G53440 1013 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10031199 [exp] 147 / 3e-40 AT1G56130 1261 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10031374 [exp] 145 / 1e-39 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10004046 [exp] 121 / 2e-31 AT4G08850 773 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2) Lus10020935 [exp] 119 / 1e-30 AT4G08850 1011 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF13855 [poplar] [flax] LRR_8 Leucine rich repeat
Representative CDS sequence Show only first row Show all	>Potri.011G073041.1 pacid=42781343 polypeptide=Potri.011G073041.1.p locus=Potri.011G073041 ID=Potri.011G073041.1.v4.1 annot-version=v4.1 ATGTGCAATTGCACCCTCAACCTCAATAATGATGGTTATTGTCATATCACGTCACTATATCTAAAAACGCTCAGTTTTTCAGGCGAGCTCCCGCCTGAAA TAACCAACCTTACATATCTTGAAATTCTTGACCTAACTCGCAACTACATTTCTGGCAATATTCCTGAGGAATGGGCTTCAATGAAACATTTGACATACCT CTCACTTACATCCAATCGCTTGTCAGGAAATATTCCTGGGTACTTGGGAAGTTTTCGTAGCCTGACTTACTTGTCCCTTGAAGCAAATCAGTTTTCTGGT ACTATTCCTTCTCAGCTTGGTAATCTTGTCAACTTAACAGACCTGATACTTTCCTCCAATCAGTTGGAGGGAACCTTGCCAGAGACTCTCGCTAATCTAA ACTTGACTAATTTTCGTGCAAGTGATAATAATCTTAGTGGCAGAATACCTGATTTCATTGGTAACTGGAGTAATCTTGATAGACTTGAATTATACGCAAG TGGACTAGAAGGGCCCATACCTACTGCCATTCTTTCTTTAGAGAAGTTGACAGACTTGAGGATCACTGATATGTCTGGACCAGAGTTTAATTTAACCAAC ATCCCTCCCATAGTGAAAAAATTGGTTTTGCGAAACATCAATTTAACTGGAGTGATCCCAAGAGATGTGTGGACATCGGGTTCTCTGACAACGCTCTAA
AA sequence Show only first row Show all	>Potri.011G073041.1 pacid=42781343 polypeptide=Potri.011G073041.1.p locus=Potri.011G073041 ID=Potri.011G073041.1.v4.1 annot-version=v4.1 MCNCTLNLNNDGYCHITSLYLKTLSFSGELPPEITNLTYLEILDLTRNYISGNIPEEWASMKHLTYLSLTSNRLSGNIPGYLGSFRSLTYLSLEANQFSG TIPSQLGNLVNLTDLILSSNQLEGTLPETLANLNLTNFRASDNNLSGRIPDFIGNWSNLDRLELYASGLEGPIPTAILSLEKLTDLRITDMSGPEFNLTN IPPIVKKLVLRNINLTGVIPRDVWTSGSLTTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G073041 [exp]	0	1
AT5G28780			PIF1 helicase (.1)		Potri.007G048501 [exp]	1.41	0.9390
AT1G18520		TET11	tetraspanin11 (.1)		Potri.015G055700 [exp]	2.44	0.9360
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.008G034200 [exp]	20.34	0.8906
AT4G00350			MATE efflux family protein (.1...		Potri.017G016450 [exp]	25.69	0.7740
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Potri.019G123800 [exp]	28.19	0.8608
					Potri.001G076350 [exp]	30.59	0.8374
AT5G53040		GRD, RKD4	RWP-RK domain-containing 4, GR...		Potri.012G016800 [exp]	31.41	0.8482
AT1G78720			SecY protein transport family ...		Potri.011G114200 [exp]	36.93	0.7721
AT5G58200			Calcineurin-like metallo-phosp...		Potri.018G111500 [exp]	37.81	0.7721
AT4G27290			S-locus lectin protein kinase ...		Potri.001G412700 [exp]	38.53	0.8326

Compare expression of checked genes

Potri.011G073041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.