Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29730 78 / 3e-18 Leucine-rich repeat transmembrane protein kinase (.1) AT1G07650 77 / 4e-18 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G29740 76 / 8e-18 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53420 74 / 4e-17 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 73 / 1e-16 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29750 72 / 4e-16 RKF1 receptor-like kinase in flowers 1 (.1.2) AT3G14840 62 / 7e-13 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53430 60 / 6e-12 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53440 51 / 6e-09 Leucine-rich repeat transmembrane protein kinase (.1) AT1G56120 48 / 6e-08 Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G073566 [exp] 148 / 2e-45 AT1G29740 262 / 1e-79 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073616 [exp] 154 / 4e-45 AT1G29740 908 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G075400 [exp] 154 / 4e-45 AT1G29740 1012 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073341 [exp] 148 / 3e-43 AT1G29740 606 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073441 [exp] 146 / 7e-43 AT1G29740 612 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073466 [exp] 147 / 1e-42 AT1G29740 1018 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073516 [exp] 144 / 2e-42 AT1G29730 644 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072966 [exp] 145 / 3e-42 AT1G29740 1006 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072866 [exp] 145 / 3e-42 AT1G29740 1024 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005418 [exp] 75 / 4e-17 AT1G29750 800 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10015239 [exp] 72 / 3e-16 AT1G29750 1189 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10031374 [exp] 70 / 1e-15 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10010951 [exp] 70 / 2e-15 AT1G07650 979 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10042505 [exp] 62 / 2e-12 AT1G53440 1013 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10038153 [exp] 58 / 4e-11 AT1G53440 1046 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005550 [exp] 54 / 6e-10 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10031199 [exp] 47 / 1e-07 AT1G56130 1261 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0202 [poplar] [flax] GBD PF11721 [poplar] [flax] Malectin Malectin domain
Representative CDS sequence Show only first row Show all	>Potri.011G073801.1 pacid=42781754 polypeptide=Potri.011G073801.1.p locus=Potri.011G073801 ID=Potri.011G073801.1.v4.1 annot-version=v4.1 ATGGATGATGAAAATTTCTATGATAACAAATATACGCTTCAATCAAATTCTAATATTTCTCTAGTTGACTTTGGATTGTATGCAACAGCACGTAAAACTC CCCTGTCTATCACTTATTATGGATATTGTCTAGAAAATGGGAATTACACTGTCAGACTCCACTTTGCTGAGATACAATTCACAGATGAAAAACTGTACAA CAAAGTTGCAAGGCGTGTTTTGATATTTACATTCTATCGGAATACAAGTGCGAAAGGATTTTAA
AA sequence Show only first row Show all	>Potri.011G073801.1 pacid=42781754 polypeptide=Potri.011G073801.1.p locus=Potri.011G073801 ID=Potri.011G073801.1.v4.1 annot-version=v4.1 MDDENFYDNKYTLQSNSNISLVDFGLYATARKTPLSITYYGYCLENGNYTVRLHFAEIQFTDEKLYNKVARRVLIFTFYRNTSAKGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29730			Leucine-rich repeat transmembr...		Potri.011G073801 [exp]	0	1
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G073416 [exp]	5.56	0.7523
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Potri.002G080066 [exp]	9.48	0.8228
AT5G27550			P-loop containing nucleoside t...		Potri.005G031500 [exp]	11.13	0.8136
AT3G22550			Protein of unknown function (D...		Potri.008G154600 [exp]	16.91	0.7585
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Potri.002G079400 [exp]	19.33	0.7472
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Potri.002G068600 [exp]	21.81	0.7693	GT2.3
AT1G69550			disease resistance protein (TI...		Potri.005G031899 [exp]	27.69	0.7745
AT3G22380		TIC	time for coffee (.1.2)		Potri.005G210200 [exp]	34.07	0.7440
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G073266 [exp]	34.35	0.6928
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.005G014700 [exp]	36.66	0.7985

Compare expression of checked genes

Potri.011G073801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.