Potri.011G074784 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00700 85 / 1e-24 ATCG00700.1, PSBN photosystem II reaction center protein N (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G113700 88 / 1e-25 ATCG00700 87 / 3e-25 photosystem II reaction center protein N (.1)
Potri.019G028300 88 / 1e-25 ATCG00700 87 / 3e-25 photosystem II reaction center protein N (.1)
Potri.007G062182 86 / 1e-24 ATCG00700 84 / 3e-24 photosystem II reaction center protein N (.1)
Potri.009G004950 75 / 1e-20 ATCG00700 79 / 2e-22 photosystem II reaction center protein N (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02468 PsbN Photosystem II reaction centre N protein (psbN)
Representative CDS sequence
>Potri.011G074784.1 pacid=42781984 polypeptide=Potri.011G074784.1.p locus=Potri.011G074784 ID=Potri.011G074784.1.v4.1 annot-version=v4.1
ATGGAAACAGTAACCCTAGTCGCCATCTCTATATCTGGTTTACTTGTAAGTTTTACTGGGTATGCCTTATATACTGCTTTTGGGCAACCCTCTCAACAAC
TAAGAGATCCATTCGAGGAACACGGGGACTAG
AA sequence
>Potri.011G074784.1 pacid=42781984 polypeptide=Potri.011G074784.1.p locus=Potri.011G074784 ID=Potri.011G074784.1.v4.1 annot-version=v4.1
METVTLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00700 ATCG00700.1, PS... photosystem II reaction center... Potri.011G074784 0 1
ATCG00700 ATCG00700.1, PS... photosystem II reaction center... Potri.011G113700 1.00 0.9360
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Potri.011G074868 7.34 0.8632
ATCG00700 ATCG00700.1, PS... photosystem II reaction center... Potri.019G028300 13.41 0.8050
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Potri.011G113575 18.16 0.8516
ATCG00340 ATCG00340.1, PS... Photosystem I, PsaA/PsaB prote... Potri.013G142124 22.27 0.7834
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Potri.017G140700 24.73 0.7796
ATCG00350 ATCG00350.1, PS... Photosystem I, PsaA/PsaB prote... Potri.004G128501 25.51 0.7634
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G074700 25.74 0.7920
Potri.014G071001 27.92 0.7854
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G113784 36.60 0.7718

Potri.011G074784 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.