Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23730 385 / 9e-136 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 370 / 1e-129 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G25810 367 / 9e-129 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT4G30270 366 / 2e-128 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT5G57560 365 / 8e-128 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57550 362 / 1e-126 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G48070 338 / 2e-117 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT5G57530 331 / 2e-114 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G57540 328 / 3e-113 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT4G25820 328 / 4e-113 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G146100 [exp] 414 / 5e-147 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G236200 [exp] 407 / 2e-144 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G060500 [exp] 398 / 1e-140 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201250 [exp] 397 / 4e-140 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201200 [exp] 395 / 1e-139 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 388 / 9e-137 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.013G005700 [exp] 373 / 3e-130 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 367 / 1e-128 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 364 / 2e-127 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028947 [exp] 381 / 5e-134 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10010936 [exp] 377 / 1e-132 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 377 / 2e-132 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10021638 [exp] 377 / 2e-132 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 377 / 2e-132 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020772 [exp] 376 / 5e-132 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020773 [exp] 376 / 6e-132 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10000678 [exp] 375 / 8e-132 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 375 / 1e-131 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031392 [exp] 374 / 2e-131 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.011G077320.1 pacid=42781732 polypeptide=Potri.011G077320.1.p locus=Potri.011G077320 ID=Potri.011G077320.1.v4.1 annot-version=v4.1 ATGGAAATTTATGTATTTTCGGTAATAGTGTTCTTGCCTTCTCTTTTTATGGCTTCTTTCATGGCTGCTTCAGCTGGTAATTTCAATCAAGAAGTTGACC TAACATGGGGTGGTGATCGTGCTAAGATACTCAGTGGAGGAAGCGTTCTGTCTCTTACACTTGATAAGGTCTCCGGCTCTGGCTTTCAATCCAAGAGCGA GTATCTCTTCGGAAGGATAGATATGCAGATCAAGCTTGTTGGTGGTAACTCTGCTGGTTCTGTCACTGCTTACTATTTATCCTCAGAAGGGCCATACCAT GATGAAATTGATTTTGAGTTCTTAGGGAACCTTAGCGGAGAACCCTATACTGTTCACACTAATGTGTACACTCAAGGGAAAGGGGATAGGGAACAACAGT TCCACCTTTGGTTTGATCCAACAAAAGATTTTCACTTGTATTCTGTTGTATGGAACCACCAACGTATCATTTTCTTAGTGGATGACACGCCTATAAGAGT GTACGAAAATCAAGAATCCATTGGAGTTCCCTTCCCGAAGAACCAACCGATGAAACTTTACTCCAGCCTATGGAATGCTGATCAGTGGGCGACAAGAGGT GGACTAGTGAAAGCAGATTGGTCTAAGGCACCTTTCACAGCATACTACAGGAATTTCAAAGCCAACGCGTGCTTATGGTCTTCAGGATCGTCTTCTTGTT CATTGAAGACTACTAGCTCCATCACAAACAATGCTTGGCAGACTCAAGGTCTGGATTCGACAAGTCGTAGAAGCCTTAGATGGGTGCAAAAATACTACAT GATTTACAATTATTGCACGGATTATAAGAGATTTCCTATGGGTCGCCCGCGTGAGTGCAGGCTTTCTAAGCATTTTTAG
AA sequence Show only first row Show all	>Potri.011G077320.1 pacid=42781732 polypeptide=Potri.011G077320.1.p locus=Potri.011G077320 ID=Potri.011G077320.1.v4.1 annot-version=v4.1 MEIYVFSVIVFLPSLFMASFMAASAGNFNQEVDLTWGGDRAKILSGGSVLSLTLDKVSGSGFQSKSEYLFGRIDMQIKLVGGNSAGSVTAYYLSSEGPYH DEIDFEFLGNLSGEPYTVHTNVYTQGKGDREQQFHLWFDPTKDFHLYSVVWNHQRIIFLVDDTPIRVYENQESIGVPFPKNQPMKLYSSLWNADQWATRG GLVKADWSKAPFTAYYRNFKANACLWSSGSSSCSLKTTSSITNNAWQTQGLDSTSRRSLRWVQKYYMIYNYCTDYKRFPMGRPRECRLSKHF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Potri.011G077320 [exp]	0	1
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.019G091800 [exp]	4.00	0.9227
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.018G095900 [exp]	4.69	0.9466
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Potri.019G125600 [exp]	6.78	0.9381
AT2G37240			Thioredoxin superfamily protei...		Potri.010G136300 [exp]	7.34	0.8914
					Potri.017G102200 [exp]	8.48	0.9297
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Potri.010G176600 [exp]	12.00	0.9339
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Potri.003G205700 [exp]	12.16	0.9332	RAP23
AT5G01750			Protein of unknown function (D...		Potri.016G131600 [exp]	13.03	0.9168
AT1G63410			Protein of unknown function (D...		Potri.001G106400 [exp]	13.41	0.9211
					Potri.001G290300 [exp]	14.83	0.9023

Compare expression of checked genes

Potri.011G077320 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.