Potri.011G077380 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14130 344 / 2e-119 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G30270 341 / 2e-118 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT3G23730 337 / 1e-116 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G48070 332 / 1e-114 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G25810 331 / 5e-114 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 329 / 2e-113 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57550 323 / 4e-111 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57530 311 / 2e-106 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT1G65310 308 / 2e-105 XTH17, XTR1, ATXTH17 xyloglucan endotransglucosylase/hydrolase 17 (.1)
AT2G18800 309 / 3e-105 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 355 / 1e-123 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201250 350 / 2e-121 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 350 / 2e-121 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 349 / 4e-121 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G236200 348 / 4e-121 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 340 / 7e-118 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G094900 335 / 9e-116 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 333 / 4e-115 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.002G060400 332 / 2e-114 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028947 352 / 2e-122 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010938 343 / 7e-119 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010939 342 / 1e-118 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 342 / 3e-118 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031392 338 / 4e-117 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 335 / 7e-116 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 334 / 2e-115 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10000678 333 / 3e-115 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 331 / 4e-114 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 330 / 7e-114 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Potri.011G077380.1 pacid=42781614 polypeptide=Potri.011G077380.1.p locus=Potri.011G077380 ID=Potri.011G077380.1.v4.1 annot-version=v4.1
ATGAATATAAGGGTTAAAGAGTCGTTAAGCAGAAGAAGAGGGAGGGCCTATCATATTGATTCACTCCCTTCTTTCCCTTTGAAGATGGCGAATAGAGTTT
CAATAACATTGTTGGTTTCTCTGTTTGTCAGCTCCTTCCTTGCTGCTTCGGCAGGTAATTTCTACCGAGATGTAGACATTACATGGGGAGATGGTCGGGG
CAAGATACTACGCCGAGGGAACACACTTTCCCTTTCTCTTGACAAGACTTCAGGCTCCGGATTCCAATCCAAGAGAGCATATCTCTTCGGAAGGTTCGAC
GTGCAAATGAAGCTTGTCCCTGGAAACTCTGCAGGGACTGTCACCACCTTCTATCTAACATCGCAAGGAAACAAGCATGACGAGATTGACTTCGAGTTCT
TGGGAAACCAAAGTGGGAACCCTTATACTTTGCATACTAATGTGTATACCCAAGGACAAGGGAATAGGGAGCAAGAATTCCGCCTGTGGTTCGATCCAAC
GTTTAAGTTTCACACGTACTCAATTATATGGAATCCCCAACGCATCATTATTTTAGTAGATAACATTCCCATAAGGGTGTTCAGTAATTTAGAAGCCATT
GGAGTTCCTTATCCCAAAAACCAGCCCATGAAGATTCAAGCAAGCCTCTGGGATGCAGAGGATTGGGCGACACAAGGTGGAAAGGTGAAAACAGACTGGT
CCATGGCTCCTTTCACTGCATATTACAGAAACTTCAGTGCACTCACTACTGACTCTAGTGGATTCAAGGGCTGGCTGACTCAAGATCTTGATGTGCAAGG
TAGAAAATTGCTCCGATGGGTGCAGAAGTATTACATGTTATACAACTATTGTGCCGATCGAAGACGCAGGTTTAGCCATCGTGAATGCACACGATCTAGG
TTCCTATGA
AA sequence
>Potri.011G077380.1 pacid=42781614 polypeptide=Potri.011G077380.1.p locus=Potri.011G077380 ID=Potri.011G077380.1.v4.1 annot-version=v4.1
MNIRVKESLSRRRGRAYHIDSLPSFPLKMANRVSITLLVSLFVSSFLAASAGNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGFQSKRAYLFGRFD
VQMKLVPGNSAGTVTTFYLTSQGNKHDEIDFEFLGNQSGNPYTLHTNVYTQGQGNREQEFRLWFDPTFKFHTYSIIWNPQRIIILVDNIPIRVFSNLEAI
GVPYPKNQPMKIQASLWDAEDWATQGGKVKTDWSMAPFTAYYRNFSALTTDSSGFKGWLTQDLDVQGRKLLRWVQKYYMLYNYCADRRRRFSHRECTRSR
FL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Potri.011G077380 0 1
AT2G38770 EMB2765 EMBRYO DEFECTIVE 2765, P-loop ... Potri.001G024401 5.47 0.5974
Potri.011G041124 9.05 0.7118
Potri.006G126750 23.32 0.5935
AT5G59030 COPT1 copper transporter 1 (.1) Potri.001G246000 23.43 0.6884
Potri.014G100650 28.28 0.6137
AT1G75717 unknown protein Potri.005G238400 28.28 0.6428
AT5G06800 GARP myb-like HTH transcriptional r... Potri.016G048000 50.47 0.6054
Potri.017G063200 51.65 0.5721
AT1G21340 DOF AtDof1,2 Dof-type zinc finger DNA-bindi... Potri.005G188900 56.92 0.6159
AT5G24920 ATGDU5 glutamine dumper 5 (.1) Potri.017G107100 57.00 0.5725

Potri.011G077380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.