Potri.011G077800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46530 165 / 6e-53 AWPM-19-like family protein (.1)
AT1G29520 163 / 4e-52 AWPM-19-like family protein (.1)
AT5G18970 85 / 3e-21 AWPM-19-like family protein (.1)
AT1G04560 70 / 2e-15 AWPM-19-like family protein (.1)
AT4G39925 43 / 4e-06 AT hook motif DNA-binding family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G354500 192 / 2e-63 AT1G29520 194 / 3e-64 AWPM-19-like family protein (.1)
Potri.008G200000 76 / 6e-18 AT5G18970 216 / 1e-72 AWPM-19-like family protein (.1)
Potri.010G064200 73 / 2e-16 AT1G04560 214 / 2e-71 AWPM-19-like family protein (.1)
Potri.008G200300 69 / 3e-15 AT5G18970 186 / 4e-61 AWPM-19-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025374 191 / 7e-63 AT5G46530 241 / 4e-83 AWPM-19-like family protein (.1)
Lus10015255 186 / 3e-61 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10011973 182 / 2e-59 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10004587 180 / 1e-58 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10041238 70 / 1e-15 AT5G18970 225 / 2e-76 AWPM-19-like family protein (.1)
Lus10001116 70 / 2e-15 AT5G18970 216 / 1e-72 AWPM-19-like family protein (.1)
Lus10021949 70 / 2e-15 AT5G18970 226 / 1e-76 AWPM-19-like family protein (.1)
Lus10023713 70 / 3e-15 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
Lus10014456 70 / 3e-15 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05512 AWPM-19 AWPM-19-like family
Representative CDS sequence
>Potri.011G077800.1 pacid=42781417 polypeptide=Potri.011G077800.1.p locus=Potri.011G077800 ID=Potri.011G077800.1.v4.1 annot-version=v4.1
ATGGCCTCTGAGCAGATGAAACCTGTTGCCTTGCTGCTTTTAGTCTTAAATCTGATCATGTATATCATCGTTTTAGGCATTGGCAGTTGGGCTATGAATA
GAGCCATTGATCATGGTTTCATCATCGGACCTGGGTATGACCTTCCAGCACATTTCTCACCCATTTTCTTCCCGATGGGAAATGCTGCCACTGGGTTCTT
CGTGACATTCTCTTTGATTGCCGGAGTTGTTGGTGTTGCCTCGGCAATTGTTGGTCTTAATCACATTCGCTCTTGGCACAGCGATAGCATGCCATCCGCC
GTCTCCACCGCTGCCATTGCCTGGGCTCTCACTCTTCTAGCCATGGGCTTTGCCAGCAAAGAAATTGAGCTCTCTATCAGGAACGCCCGTCTGAGAACCA
TGGAAGCATTTATGATCATACTTTCTGCTACGCAACTTCTATACATAGCAGCCATCCATGGCGCCTCATCAAGTAGAAGAACTTGA
AA sequence
>Potri.011G077800.1 pacid=42781417 polypeptide=Potri.011G077800.1.p locus=Potri.011G077800 ID=Potri.011G077800.1.v4.1 annot-version=v4.1
MASEQMKPVALLLLVLNLIMYIIVLGIGSWAMNRAIDHGFIIGPGYDLPAHFSPIFFPMGNAATGFFVTFSLIAGVVGVASAIVGLNHIRSWHSDSMPSA
VSTAAIAWALTLLAMGFASKEIELSIRNARLRTMEAFMIILSATQLLYIAAIHGASSSRRT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G46530 AWPM-19-like family protein (.... Potri.011G077800 0 1
AT2G20362 unknown protein Potri.002G256100 1.00 0.9105
AT1G68585 unknown protein Potri.015G053600 17.83 0.7975
AT5G41470 Nuclear transport factor 2 (NT... Potri.001G100500 21.26 0.8493
AT5G22870 Late embryogenesis abundant (L... Potri.009G003800 25.74 0.8418
AT5G45540 Protein of unknown function (D... Potri.003G064200 29.93 0.8324
AT1G54860 Glycoprotein membrane precurso... Potri.005G034300 30.52 0.8390
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Potri.011G135400 34.20 0.8373
AT5G49320 Protein of unknown function (D... Potri.008G108900 37.78 0.8331
AT3G50120 Plant protein of unknown funct... Potri.001G071400 38.02 0.8348
AT5G49525 unknown protein Potri.013G007500 41.32 0.7496

Potri.011G077800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.