Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL32.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18100 226 / 1e-77 Ribosomal protein L32e (.1) AT5G46430 223 / 1e-76 Ribosomal protein L32e (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G353900 [exp] 241 / 1e-83 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1) Potri.014G191000 [exp] 241 / 1e-83 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1) Potri.002G249000 [exp] 238 / 1e-82 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012195 [exp] 230 / 2e-79 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1) Lus10007541 [exp] 230 / 2e-79 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1) Lus10011970 [exp] 229 / 9e-79 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1) Lus10004589 [exp] 228 / 2e-78 AT4G18100 247 / 4e-86 Ribosomal protein L32e (.1) Lus10020410 [exp] 227 / 4e-78 AT4G18100 242 / 3e-84 Ribosomal protein L32e (.1) Lus10031699 [exp] 226 / 1e-77 AT4G18100 240 / 2e-83 Ribosomal protein L32e (.1) Lus10009591 [exp] 225 / 3e-76 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1) Lus10031120 [exp] 226 / 5e-74 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01655 [poplar] [flax] Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence Show only first row Show all	>Potri.011G078200.1 pacid=42782377 polypeptide=Potri.011G078200.1.p locus=Potri.011G078200 ID=Potri.011G078200.1.v4.1 annot-version=v4.1 ATGGCGGTGCCGTTGCTTACGAAGAAGATTGTTAAGAAGAGAGTTAAGAAGTTCAAGAGGCCACAAAGTGACCGCAAGATCTCTGTCAAGACAAGCTGGC GCAGACCAAAGGGTATTGATTCTCGTGTTCGAAGAAAGTTCAAGGGATGTACTCTGATGCCCAATATCGGTTATGGTTCTGACAAGAAGACTCGTCATTA TCTTCCAAACTGCTTCAAGAAATTTGTTGTCCACAATGTCAAAGAGCTAGAGGTGTTGATGATGCACAACAGGACTTACTGCGCTGAGATAGCACATAAC GTGTCAACAAGGAAAAGGAAAGAGATTGTGGAGCGAGCTGCGCAGCTTGATGTTGTTGTAACTAACAAGCTCGCTAGGTTGCGTAGCCAGGAGGACGAAT GA
AA sequence Show only first row Show all	>Potri.011G078200.1 pacid=42782377 polypeptide=Potri.011G078200.1.p locus=Potri.011G078200 ID=Potri.011G078200.1.v4.1 annot-version=v4.1 MAVPLLTKKIVKKRVKKFKRPQSDRKISVKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNCFKKFVVHNVKELEVLMMHNRTYCAEIAHN VSTRKRKEIVERAAQLDVVVTNKLARLRSQEDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G18100			Ribosomal protein L32e (.1)		Potri.011G078200 [exp]	0	1	RPL32.1
AT2G30620			winged-helix DNA-binding trans...		Potri.008G162300 [exp]	1.73	0.8640
AT3G60910			S-adenosyl-L-methionine-depend...		Potri.009G055600 [exp]	6.63	0.8184
AT5G56190			Transducin/WD40 repeat-like su...		Potri.016G000800 [exp]	10.00	0.8611
AT1G79070			SNARE-associated protein-relat...		Potri.008G043200 [exp]	10.24	0.8486
AT4G31790			Tetrapyrrole (Corrin/Porphyrin...		Potri.002G023700 [exp]	11.40	0.8141
AT3G48480			Cysteine proteinases superfami...		Potri.015G090800 [exp]	12.32	0.8628
AT3G48140			B12D protein (.1)		Potri.010G055300 [exp]	13.41	0.8066
AT2G38450			unknown protein		Potri.008G075000 [exp]	17.20	0.8484
					Potri.013G126650 [exp]	19.74	0.8383
AT3G14930		HEME1	Uroporphyrinogen decarboxylase...		Potri.011G109800 [exp]	19.97	0.8202

Compare expression of checked genes

Potri.011G078200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.