Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18240 77 / 2e-18 ATSS4, SSIV ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1) AT1G11720 48 / 3e-08 ATSS3 starch synthase 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G351800 [exp] 77 / 1e-18 AT4G18240 1293 / 0.0 ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1) Potri.018G149500 [exp] 50 / 1e-08 AT4G18240 449 / 4e-146 ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1) Potri.004G014100 [exp] 44 / 1e-06 AT1G11720 1460 / 0.0 starch synthase 3 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038491 [exp] 81 / 1e-19 AT4G18240 1278 / 0.0 ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1) Lus10023319 [exp] 79 / 5e-19 AT4G18240 1303 / 0.0 ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1) Lus10028133 [exp] 71 / 2e-16 AT4G18240 1285 / 0.0 ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1) Lus10042837 [exp] 71 / 4e-16 AT4G18240 1281 / 0.0 ARABIDOPSIS THALIANA STARCH SYNTHASE 4, starch synthase 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G079450.1 pacid=42780283 polypeptide=Potri.011G079450.1.p locus=Potri.011G079450 ID=Potri.011G079450.1.v4.1 annot-version=v4.1 ATGATAGCTATCAGATATGGTTCCATGCCAATTGCAAGAAAAACCGGTGATCTAAATGAGAGTGTTTTTGATGTTGATGATGATACCGTCCCTCTCCGAT TTCCAAATGGCTTTACATTCTTGACTCCCGGTGAACTTGTAAATAACCAGAGCTGCAGATTTAGTTGTAGTATCTCTTTCATGCTTTCCAATTGA
AA sequence Show only first row Show all	>Potri.011G079450.1 pacid=42780283 polypeptide=Potri.011G079450.1.p locus=Potri.011G079450 ID=Potri.011G079450.1.v4.1 annot-version=v4.1 MIAIRYGSMPIARKTGDLNESVFDVDDDTVPLRFPNGFTFLTPGELVNNQSCRFSCSISFMLSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G18240		ATSS4, SSIV	ARABIDOPSIS THALIANA STARCH SY...		Potri.011G079450 [exp]	0	1
AT5G52140			RING/U-box superfamily protein...		Potri.012G136400 [exp]	4.35	0.7892
AT5G10760			Eukaryotic aspartyl protease f...		Potri.018G014500 [exp]	17.83	0.7716
AT5G54850			unknown protein		Potri.011G136600 [exp]	19.07	0.7820
AT4G25570		ACYB-2	Cytochrome b561/ferric reducta...		Potri.012G141000 [exp]	30.98	0.7448
AT5G41761			unknown protein		Potri.001G364550 [exp]	33.49	0.7252
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.004G158200 [exp]	43.39	0.7423
AT5G56320		ATHEXPALPHA1.5,...	EXPANSIN 14, expansin A14 (.1)		Potri.003G223501 [exp]	45.38	0.7149
					Potri.018G003201 [exp]	45.60	0.7210
					Potri.004G063101 [exp]	47.60	0.7149
					Potri.009G062400 [exp]	49.29	0.6896

Compare expression of checked genes

Potri.011G079450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.