Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29951 53 / 1e-11 CPuORF35 conserved peptide upstream open reading frame 35 (.1) AT5G50011 44 / 5e-08 CPuORF37 conserved peptide upstream open reading frame 37 (.1) AT5G64341 40 / 1e-06 CPuORF40 conserved peptide upstream open reading frame 40 (.1) AT5G09461 39 / 4e-06 CPuORF43 conserved peptide upstream open reading frame 43 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G112900 [exp] 48 / 8e-10 AT5G50011 87 / 5e-25 conserved peptide upstream open reading frame 37 (.1) Potri.017G047932 [exp] 43 / 8e-08 AT5G50011 86 / 2e-24 conserved peptide upstream open reading frame 37 (.1) Potri.005G158000 [exp] 43 / 1e-07 AT5G50011 88 / 2e-25 conserved peptide upstream open reading frame 37 (.1) Potri.002G103400 [exp] 43 / 1e-07 AT5G50011 88 / 2e-25 conserved peptide upstream open reading frame 37 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040879 [exp] 42 / 2e-06 AT1G29950 130 / 2e-36 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10004927 [exp] 39 / 2e-05 AT1G29950 126 / 6e-34 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G080100.1 pacid=42782284 polypeptide=Potri.011G080100.1.p locus=Potri.011G080100 ID=Potri.011G080100.1.v4.1 annot-version=v4.1 ATGTACATTGCGGTAACCATAAAGAGATATCGAGCTGTGAAGGAAGTAGGGGAGATCAAAATTAGCGTTGGGATTACTGCGTATTATCAAGTGATGCAGA TTTGTCAGGCTGAGTATTTCCGCCAGTTACTTAAGCCTGTTACGTAG
AA sequence Show only first row Show all	>Potri.011G080100.1 pacid=42782284 polypeptide=Potri.011G080100.1.p locus=Potri.011G080100 ID=Potri.011G080100.1.v4.1 annot-version=v4.1 MYIAVTIKRYRAVKEVGEIKISVGITAYYQVMQICQAEYFRQLLKPVT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29951		CPuORF35	conserved peptide upstream ope...		Potri.011G080100 [exp]	0	1
AT5G50011		CPuORF37	conserved peptide upstream ope...		Potri.007G112900 [exp]	3.74	0.6804
AT5G50011		CPuORF37	conserved peptide upstream ope...		Potri.005G158000 [exp]	5.83	0.7420
					Potri.010G080633 [exp]	9.32	0.7414
AT5G52552		CPuORF14	conserved peptide upstream ope...		Potri.017G143300 [exp]	11.18	0.7263
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	13.41	0.7275
					Potri.013G068601 [exp]	16.88	0.6741
AT5G03190		CPuORF47	conserved peptide upstream ope...		Potri.016G088850 [exp]	17.54	0.7174
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	19.89	0.7218
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	24.91	0.7147
AT5G65950			unknown protein		Potri.001G457201 [exp]	31.12	0.6701

Compare expression of checked genes

Potri.011G080100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.