Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPS14.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52580 238 / 4e-82 Ribosomal protein S11 family protein (.1) AT3G11510 237 / 1e-81 Ribosomal protein S11 family protein (.1) AT2G36160 234 / 1e-80 Ribosomal protein S11 family protein (.1) ATCG00750 53 / 1e-09 ATCG00750.1, RPS11 ribosomal protein S11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G218700 [exp] 252 / 1e-87 AT3G52580 241 / 4e-83 Ribosomal protein S11 family protein (.1) Potri.009G019400 [exp] 250 / 1e-86 AT3G52580 241 / 4e-83 Ribosomal protein S11 family protein (.1) Potri.004G131800 [exp] 249 / 2e-86 AT3G52580 235 / 7e-81 Ribosomal protein S11 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022693 [exp] 232 / 2e-78 AT3G11510 261 / 2e-89 Ribosomal protein S11 family protein (.1) Lus10021315 [exp] 235 / 2e-76 AT3G52570 397 / 2e-136 alpha/beta-Hydrolases superfamily protein (.1) Lus10016992 [exp] 233 / 2e-75 AT3G52570 433 / 1e-150 alpha/beta-Hydrolases superfamily protein (.1) Lus10014220 [exp] 206 / 1e-66 AT3G11510 236 / 4e-78 Ribosomal protein S11 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0267 [poplar] [flax] S11_L18p PF00411 [poplar] [flax] Ribosomal_S11 Ribosomal protein S11
Representative CDS sequence Show only first row Show all	>Potri.011G080500.2 pacid=42781794 polypeptide=Potri.011G080500.2.p locus=Potri.011G080500 ID=Potri.011G080500.2.v4.1 annot-version=v4.1 ATGTCAAAGAGAAGGACTAGAGAACCAAAGGAAGAAAATGTGACCCTTGGACCCACCGTGAGGGAAGGGGAGCATGCTTTTGGGGTTGCTCACATCTTCG CATCTTTTAATGACACATTCATTCATGTGACTGATCTCTCTGGAAGAGAAACCCTTGTCCGCATAACTGGTGGAATGAAGGTGAAAGCTGATAGAGATGA ATCTTCACCATATGCTGCCATGCTTGCTGCACAAGATGTTTCACAGAGATGCAAGGAACTCGGTATCACTGCCCTTCATATTAAGCTTCGTGCTACTGGT GGGAACAAGACAAAGACACCTGGTCCAGGTGCACAGTCTGCCCTGCGTGCCCTTGCCCGTTCTGGAATGAGAATTGGCCGCATAGAAGATGTTACTCCAA TTCCAACGGATAGCACTCGTAGAAAGGGTGGCAGAAGAGGTAGAAGGCTGTGA
AA sequence Show only first row Show all	>Potri.011G080500.2 pacid=42781794 polypeptide=Potri.011G080500.2.p locus=Potri.011G080500 ID=Potri.011G080500.2.v4.1 annot-version=v4.1 MSKRRTREPKEENVTLGPTVREGEHAFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGITALHIKLRATG GNKTKTPGPGAQSALRALARSGMRIGRIEDVTPIPTDSTRRKGGRRGRRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52580			Ribosomal protein S11 family p...		Potri.011G080500 [exp]	0	1	Pt-RPS14.3
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.015G129800 [exp]	2.23	0.9310	RPS20.2
AT5G39850			Ribosomal protein S4 (.1)		Potri.011G094500 [exp]	2.44	0.8829
AT1G47420		SDH5	succinate dehydrogenase 5 (.1)		Potri.014G032400 [exp]	3.74	0.9098
AT5G23290		PFD5, PDF5	prefoldin 5 (.1)		Potri.007G074042 [exp]	6.70	0.8592
AT5G09900		RPN5A, MSA, EMB...	REGULATORY PARTICLE NON-ATPASE...		Potri.005G087100 [exp]	8.83	0.8629
AT5G18800			Cox19-like CHCH family protein...		Potri.010G026000 [exp]	8.94	0.8693
AT4G29735			unknown protein		Potri.004G215200 [exp]	10.00	0.8810
AT5G49540			Rab5-interacting family protei...		Potri.008G102200 [exp]	10.39	0.8548
AT3G11730		ATFP8, AtRABD1	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.003G004000 [exp]	10.67	0.7809
AT3G22480		PDF2	prefoldin 2 (.1.2)		Potri.001G240200 [exp]	13.85	0.8492

Compare expression of checked genes

Potri.011G080500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.