Potri.011G080800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50720 130 / 3e-39 Stigma-specific Stig1 family protein (.1)
AT5G55110 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
AT4G26880 120 / 3e-35 Stigma-specific Stig1 family protein (.1)
AT1G11925 91 / 6e-24 Stigma-specific Stig1 family protein (.1)
AT1G53130 69 / 4e-15 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT1G50650 64 / 3e-13 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G356600 262 / 3e-91 AT1G50720 133 / 2e-40 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 115 / 4e-33 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 102 / 3e-28 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 97 / 5e-26 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007000 96 / 9e-26 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.010G228100 96 / 1e-25 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 94 / 2e-24 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 92 / 3e-24 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 89 / 3e-23 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043047 141 / 3e-43 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10011146 139 / 1e-42 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10011117 138 / 7e-42 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10020831 81 / 8e-20 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10012679 79 / 3e-19 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10041930 68 / 6e-15 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10000696 67 / 9e-14 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Lus10005544 63 / 2e-13 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10006512 63 / 4e-13 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Potri.011G080800.1 pacid=42781816 polypeptide=Potri.011G080800.1.p locus=Potri.011G080800 ID=Potri.011G080800.1.v4.1 annot-version=v4.1
ATGCAACTCGTCAAGATAATCTTCGTTATAGCTATAACAACGGCTTTCTCCATCGCTCTCACAATGAAAAGTGTTGTCGAAGTTGAAGAGAAACAACCAT
ATGAGCATAGTATTGATACATCAACGACATTGTCTCAAGGGCTTATCATGCATGATGAAAAGAAGCTAATGCCTTCAAAAAGGTTGAGTCGGTTCCTCAC
AGAAGAAAAAAACCCTAGAGCAGCTGACCACTGCTACAAAGACAATGAAATATGCCATATTCAGCAGGGTAAAAACCATAAATGTTGCAGCAACAAGTGC
ATGGACTTAAATACAGACAAACACAACTGCGGTTCATGCAAGAGAAAGTGTAAATACACAGAAGATTGTTGCAGAGGAGAGTGTGTACTGCTTTCTCTTG
ATAAGAGGCACTGCGGGAGGTGCAATAACCGGTGCCAGGACGGAGAATTTTGCGTCTATGGAATGTGTAATTATCCATAA
AA sequence
>Potri.011G080800.1 pacid=42781816 polypeptide=Potri.011G080800.1.p locus=Potri.011G080800 ID=Potri.011G080800.1.v4.1 annot-version=v4.1
MQLVKIIFVIAITTAFSIALTMKSVVEVEEKQPYEHSIDTSTTLSQGLIMHDEKKLMPSKRLSRFLTEEKNPRAADHCYKDNEICHIQQGKNHKCCSNKC
MDLNTDKHNCGSCKRKCKYTEDCCRGECVLLSLDKRHCGRCNNRCQDGEFCVYGMCNYP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G50720 Stigma-specific Stig1 family p... Potri.011G080800 0 1
AT2G21660 CCR2, ATGRP7, G... GLYCINE-RICH RNA-BINDING PROTE... Potri.009G116400 27.56 0.5192
AT5G27820 Ribosomal L18p/L5e family prot... Potri.005G068300 112.06 0.4669
AT3G30390 Transmembrane amino acid trans... Potri.010G136601 146.96 0.4432
AT4G18950 Integrin-linked protein kinase... Potri.004G064400 205.99 0.4386

Potri.011G080800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.