Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-HHOA.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18370 356 / 3e-123 DEGP5, DEG5, HHOA PROTEASE HHOA PRECUSOR, DEGP protease 5 (.1) AT5G39830 189 / 2e-56 DEG8, DEGP8 DEG PROTEASE 8, Trypsin family protein with PDZ domain (.1.2) AT3G27925 187 / 6e-56 DEGP, DegP1, DEG1 DegP protease 1 (.1) AT5G27660 88 / 2e-19 Trypsin family protein with PDZ domain (.1) AT5G36950 54 / 6e-08 DEGP10 DegP protease 10 (.1) AT1G65630 53 / 1e-07 DEGP3 DegP protease 3 (.1) AT1G65640 49 / 2e-06 DEGP4 DegP protease 4 (.1) AT5G40560 49 / 2e-06 DEGP13 DegP protease 13 (.1) AT2G47940 48 / 7e-06 EMB3117, DEGP2 EMBRYO DEFECTIVE 3117, DEGP protease 2 (.1.2) AT5G40200 45 / 4e-05 DEGP9 DegP protease 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G348800 [exp] 189 / 9e-57 AT3G27925 595 / 0.0 DegP protease 1 (.1) Potri.004G129200 [exp] 188 / 5e-56 AT5G39830 595 / 0.0 DEG PROTEASE 8, Trypsin family protein with PDZ domain (.1.2) Potri.013G018300 [exp] 91 / 2e-20 AT5G27660 516 / 0.0 Trypsin family protein with PDZ domain (.1) Potri.004G065600 [exp] 70 / 3e-15 AT4G18370 55 / 1e-10 PROTEASE HHOA PRECUSOR, DEGP protease 5 (.1) Potri.008G079900 [exp] 49 / 4e-06 AT5G36950 857 / 0.0 DegP protease 10 (.1) Potri.015G073100 [exp] 46 / 3e-05 AT5G40200 842 / 0.0 DegP protease 9 (.1) Potri.014G135200 [exp] 45 / 7e-05 AT2G47940 932 / 0.0 EMBRYO DEFECTIVE 3117, DEGP protease 2 (.1.2) Potri.002G207200 [exp] 44 / 0.0001 AT2G47940 931 / 0.0 EMBRYO DEFECTIVE 3117, DEGP protease 2 (.1.2) Potri.012G077900 [exp] 43 / 0.0002 AT5G40200 845 / 0.0 DegP protease 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042822 [exp] 365 / 1e-126 AT4G18370 329 / 3e-112 PROTEASE HHOA PRECUSOR, DEGP protease 5 (.1) Lus10028120 [exp] 317 / 3e-107 AT4G18370 284 / 4e-94 PROTEASE HHOA PRECUSOR, DEGP protease 5 (.1) Lus10008781 [exp] 195 / 9e-59 AT3G27925 641 / 0.0 DegP protease 1 (.1) Lus10007262 [exp] 193 / 2e-58 AT5G39830 597 / 0.0 DEG PROTEASE 8, Trypsin family protein with PDZ domain (.1.2) Lus10022234 [exp] 176 / 5e-51 AT3G27925 623 / 0.0 DegP protease 1 (.1) Lus10037815 [exp] 92 / 9e-21 AT5G27660 491 / 9e-173 Trypsin family protein with PDZ domain (.1) Lus10017093 [exp] 72 / 5e-14 AT5G27660 393 / 9e-135 Trypsin family protein with PDZ domain (.1) Lus10005931 [exp] 50 / 8e-07 AT2G47940 452 / 8e-155 EMBRYO DEFECTIVE 3117, DEGP protease 2 (.1.2) Lus10032163 [exp] 49 / 4e-06 AT5G40200 843 / 0.0 DegP protease 9 (.1) Lus10024525 [exp] 47 / 1e-05 AT5G36950 764 / 0.0 DegP protease 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0124 [poplar] [flax] Peptidase_PA PF00089 [poplar] [flax] Trypsin Trypsin
Representative CDS sequence Show only first row Show all	>Potri.011G083300.2 pacid=42780616 polypeptide=Potri.011G083300.2.p locus=Potri.011G083300 ID=Potri.011G083300.2.v4.1 annot-version=v4.1 ATGGTGGTGTTGGGTTCAATTCATGCTCCCTCCGCTCTCTCTCCACTCCAAAAGATGACCGTTTCTTCTTCAGATAATAAGAGCCTAGTTCTTGGAAGAC GAAGAACCATAGCCGTTGGTTCCAGCGCTGTAGTACTGGCTTCCCTACTCAACTTGCACAATCCCATTTCAAACCCTCCTTTGCTTCACTCTGCTTTTGC CCAACAACAAGATGAACTTCAGCAACAAGAGGATAGAGTCGCTCACCTCTTCCAGGAATCCTCACCATCAGTTGTTTTTATCAAGGACATCGAGTTAGCT AAAGTTCCTAACAGGCCTGAAGATCGGTTTATGCTTACGGAGGATGAAAATGCCAAAGTCGAAGGAACAGGTTCGGGCTTCATCTGGGATAAGTTTGGTC ACATTGTAACAAATTACCATGTTGTAGCTAAATTGGCAACAGATAAAAGCGGATTACAGTGTTGTAAGGTATTTCTAGTTGATGCTGGAGGCAATAGCTT GTACAGGGAAGGCACGATTATTGGTTTTGATCCATCTTATGATCTGGCTGTCCTTAAGGTCGATGTTGAAGGATATGAATTGAAGCCAGCTACTCTTGGT ACTTCTAGGGAATTACATGTGGGTCAAAGTTGTTTTGCCATTGGGAATCCTTATGGATATGAAAACACTCTAACAACAGGGGTGGTCAGCGGCTTGGGTA GAGAAATCCCTTCACCAAATGGAAAGGCCATTCGTGGAGCTATTCAAACAGATGCAGATATTAATGCAGGGAATTCAGGTGGACCATTGATTGATTCATA TGGACATGTCATTGGAGTCAACACAGCAACCTTCACCCGGAAAGGGACAGGGGCATCCTCTGGGGTGAATTTTGCAATACCAATCGACACGGTTGTGCAA TATGTACCAATTCTTATTGTTTATGGAACTCCTTATAAAGATAGGTTTTGA
AA sequence Show only first row Show all	>Potri.011G083300.2 pacid=42780616 polypeptide=Potri.011G083300.2.p locus=Potri.011G083300 ID=Potri.011G083300.2.v4.1 annot-version=v4.1 MVVLGSIHAPSALSPLQKMTVSSSDNKSLVLGRRRTIAVGSSAVVLASLLNLHNPISNPPLLHSAFAQQQDELQQQEDRVAHLFQESSPSVVFIKDIELA KVPNRPEDRFMLTEDENAKVEGTGSGFIWDKFGHIVTNYHVVAKLATDKSGLQCCKVFLVDAGGNSLYREGTIIGFDPSYDLAVLKVDVEGYELKPATLG TSRELHVGQSCFAIGNPYGYENTLTTGVVSGLGREIPSPNGKAIRGAIQTDADINAGNSGGPLIDSYGHVIGVNTATFTRKGTGASSGVNFAIPIDTVVQ YVPILIVYGTPYKDRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G18370		DEGP5, DEG5, HH...	PROTEASE HHOA PRECUSOR, DEGP p...		Potri.011G083300 [exp]	0	1	Pt-HHOA.1
AT5G30510		ARRPS1, RPS1	ribosomal protein S1 (.1)		Potri.008G101100 [exp]	2.23	0.9884
AT3G63140		CSP41A	chloroplast stem-loop binding ...		Potri.005G209500 [exp]	2.44	0.9871
AT2G38780			unknown protein		Potri.001G024200 [exp]	2.82	0.9843
AT2G25080		ATGPX1	glutathione peroxidase 1 (.1)		Potri.006G265400 [exp]	4.00	0.9806
AT4G19100		PAM68	photosynthesis affected mutant...		Potri.001G132001 [exp]	4.24	0.9845
AT2G34860		EDA3	embryo sac development arrest ...		Potri.001G009800 [exp]	4.47	0.9841
AT3G19810			Protein of unknown function (D...		Potri.010G170100 [exp]	6.48	0.9749
AT2G33800		EMB3113	EMBRYO DEFECTIVE 3113, Ribosom...		Potri.004G045700 [exp]	7.34	0.9823
AT1G32990		PRPL11	plastid ribosomal protein l11 ...		Potri.001G450800 [exp]	8.36	0.9806
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Potri.004G120300 [exp]	8.77	0.9796

Compare expression of checked genes

Potri.011G083300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.