Potri.011G084201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00900 186 / 4e-62 ATCG00900.1, RPS7.1 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
ATCG01240 186 / 4e-62 ATCG01240.1, RPS7.2 ribosomal protein S7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G138900 191 / 3e-64 ATCG00900 310 / 2e-110 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Potri.004G140500 148 / 2e-46 ATCG00900 249 / 2e-85 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002394 128 / 2e-38 ATCG00900 229 / 3e-77 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Lus10027894 0 / 1 ATCG00900 167 / 7e-53 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00177 Ribosomal_S7 Ribosomal protein S7p/S5e
Representative CDS sequence
>Potri.011G084201.1 pacid=42781516 polypeptide=Potri.011G084201.1.p locus=Potri.011G084201 ID=Potri.011G084201.1.v4.1 annot-version=v4.1
ATGTCACGTCGAGGTACTACAGAAGAAAAAACTGCAAAATCCGATCTAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACG
AAAAAAAATCATTGGCTTATCAAATTCTCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACTATCTGTTTTACATCAAGCAATACG
TGGAGTAACTCCCGATATAGCAGTAAAAGCAAGACGTGTAGGCGGATCGACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAAACTTGCCA
TTCGTTGGTTATTAG
AA sequence
>Potri.011G084201.1 pacid=42781516 polypeptide=Potri.011G084201.1.p locus=Potri.011G084201 ID=Potri.011G084201.1.v4.1 annot-version=v4.1
MSRRGTTEEKTAKSDLIYRNRLVNMLVNRILKHEKKSLAYQILYRAMKKIQQKTETNPLSVLHQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKNLP
FVGY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.011G084201 0 1
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.013G138900 1.41 0.9966
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.011G075200 3.87 0.9928
Potri.007G062102 4.35 0.9660
ATCG00280 ATCG00280.1, PS... photosystem II reaction center... Potri.008G208700 14.28 0.9678
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.012G047500 15.87 0.9773
ATCG00730 ATCG00730.1, PE... photosynthetic electron transf... Potri.013G088900 17.74 0.9654
AT5G50740 Heavy metal transport/detoxifi... Potri.015G099500 20.88 0.9121
ATCG00180 ATCG00180.1, RP... DNA-directed RNA polymerase fa... Potri.013G140850 22.49 0.9646
ATCG00750 ATCG00750.1, RP... ribosomal protein S11 (.1) Potri.010G032501 22.51 0.9721
AT1G76810 eukaryotic translation initiat... Potri.019G103600 23.36 0.9349

Potri.011G084201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.