Potri.011G087100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT1G67600 164 / 3e-52 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 160 / 1e-50 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G61770 109 / 2e-29 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 73 / 4e-16 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156000 192 / 3e-63 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 189 / 4e-62 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.010G056600 155 / 1e-48 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.002G171300 110 / 1e-29 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 54 / 7e-09 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000883 211 / 1e-70 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 205 / 4e-68 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10035299 191 / 2e-62 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 164 / 4e-51 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10011373 152 / 2e-47 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10006432 151 / 5e-47 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 134 / 3e-41 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10030253 112 / 2e-32 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10014550 56 / 1e-10 AT3G61770 115 / 4e-33 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 53 / 2e-08 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Potri.011G087100.1 pacid=42781669 polypeptide=Potri.011G087100.1.p locus=Potri.011G087100 ID=Potri.011G087100.1.v4.1 annot-version=v4.1
ATGGACGAAGTGATGACAGCTGCTGATGCATCGTCCAGATATCGATCAGCAACATCTCCACCCGCTAGTCTCCCCTCCAACATTCCTCTCCTTTCCGCCT
TCCTTGCCTTTTCACTTGCCCAGTTCCTCAAGCTTTTCACCACCTGGTTCAAGGAGAAGAGATGGGATGCTAGAAGGATGCTTGGGTCAGGTGGAATGCC
CTCATCCCATTCAGCAACCGTGACTGCTCTAGCAACCGCTATTGGTCTGCAAGAAGGAACTGGAGCACCAGCATTTGCTGTTGCATTGGTTTTGGCATGC
GTTGTTATGTATGATGCAACTGGTGTTAGACTTCATGCTGGTCGCCAAGCTGAGTTACTAAATCAAATTGTCTGCGAGCTACCTCCGGAACACCCTGTCT
CCAATGTTAGACCCCTACGGGATTCACTTGGTCACACTCCACTCCAGGTTGTTGCGGGTGCAGTGTTGGGGTGTATTATAGCTTTCCTCATGAGAAGTTC
TAGCTAG
AA sequence
>Potri.011G087100.1 pacid=42781669 polypeptide=Potri.011G087100.1.p locus=Potri.011G087100 ID=Potri.011G087100.1.v4.1 annot-version=v4.1
MDEVMTAADASSRYRSATSPPASLPSNIPLLSAFLAFSLAQFLKLFTTWFKEKRWDARRMLGSGGMPSSHSATVTALATAIGLQEGTGAPAFAVALVLAC
VVMYDATGVRLHAGRQAELLNQIVCELPPEHPVSNVRPLRDSLGHTPLQVVAGAVLGCIIAFLMRSSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G21610 Acid phosphatase/vanadium-depe... Potri.011G087100 0 1
AT1G05805 bHLH bHLH128 basic helix-loop-helix (bHLH) ... Potri.002G231700 23.91 0.7892
AT4G31420 C2H2ZnF Zinc finger protein 622 (.1.2) Potri.006G275300 34.98 0.7663 FZF.2
AT5G11170 DEAD/DEAH box RNA helicase fam... Potri.018G028600 35.07 0.7787
AT3G06180 Ribosomal protein L34e superfa... Potri.008G201700 36.11 0.7751
AT2G41500 EMB2776, LIS LACHESIS, WD-40 repeat family ... Potri.006G045800 36.94 0.7828
AT1G36370 SHM7 serine hydroxymethyltransferas... Potri.001G212000 52.86 0.7660 SHMT9
AT2G40780 Nucleic acid-binding, OB-fold-... Potri.019G061200 60.79 0.7584
AT5G11170 DEAD/DEAH box RNA helicase fam... Potri.006G253100 66.61 0.7610
AT1G55190 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, ... Potri.002G044000 66.96 0.7589
AT4G38130 ATHDA19, ATHD1,... ARABIDOPSIS HISTONE DEACETYLAS... Potri.009G170700 76.13 0.7296 HDA902,RPD3.1

Potri.011G087100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.