Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55850 123 / 6e-38 NOI RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) AT2G04410 98 / 4e-28 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G40645 76 / 2e-19 RPM1-interacting protein 4 (RIN4) family protein (.1) AT4G35655 71 / 1e-17 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G63270 71 / 2e-17 RPM1-interacting protein 4 (RIN4) family protein (.1) AT2G17660 70 / 4e-17 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G48450 66 / 5e-15 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G25070 51 / 9e-09 RIN4 RPM1 interacting protein 4 (.1) AT5G19473 38 / 0.0003 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G368900 [exp] 149 / 3e-48 AT5G55850 124 / 4e-39 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.014G168900 [exp] 108 / 3e-32 AT2G04410 102 / 1e-30 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.015G089201 [exp] 86 / 5e-23 AT2G04410 90 / 1e-25 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.012G092601 [exp] 81 / 1e-20 AT2G04410 78 / 3e-20 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.001G338500 [exp] 78 / 4e-20 AT5G40645 82 / 1e-22 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.002G245400 [exp] 54 / 1e-09 AT3G25070 169 / 3e-52 RPM1 interacting protein 4 (.1) Potri.011G022000 [exp] 53 / 3e-09 AT3G25070 74 / 6e-16 RPM1 interacting protein 4 (.1) Potri.004G002500 [exp] 50 / 2e-08 AT3G25070 75 / 1e-16 RPM1 interacting protein 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022524 [exp] 116 / 3e-35 AT2G04410 104 / 2e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10016623 [exp] 114 / 3e-34 AT2G04410 105 / 1e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10012316 [exp] 84 / 2e-22 AT5G55850 87 / 4e-24 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10025949 [exp] 74 / 2e-18 AT2G17660 87 / 2e-24 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10032112 [exp] 74 / 5e-18 AT5G55850 80 / 1e-20 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10006361 [exp] 72 / 1e-17 AT5G55850 73 / 7e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10014574 [exp] 67 / 5e-16 AT5G55850 76 / 1e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10040889 [exp] 59 / 1e-11 AT1G53000 147 / 6e-44 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1) Lus10006250 [exp] 52 / 1e-09 AT5G55850 52 / 7e-10 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10036939 [exp] 52 / 1e-09 AT3G25070 52 / 7e-10 RPM1 interacting protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05627 [poplar] [flax] AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence Show only first row Show all	>Potri.011G094200.3 pacid=42780458 polypeptide=Potri.011G094200.3.p locus=Potri.011G094200 ID=Potri.011G094200.3.v4.1 annot-version=v4.1 ATGATAGAATACAGACAGGCCCATTTAAAGTCCATTTCACACTGTCTCTCTCTCCAAAAGGCACACTCTGTCTATCTCTCTCTCTCTGTTAATCGATTCC CTGCTTCACCTGAAAGTCTCTCTCTAGAATTCATGTCGGACACAGGTCGGCCACTGCCAAAATTTGGTGAATGGGATGTCAATGATCCTGCATCAGCTGA GGGATTCACTGTAATTTTTAACAAGGCAAGGGATGAGAAGAAGACAGGTGGCCAGCCGGAATCACCAGGAAAGGTTGTTGATTCTCATGTTAAGCCTGGA TTAAATCCTGCCAAATCTCAGCCTAAAAAATGGTTTTGCTGCATCCAAAGTCCGCATGTGGAGTCTTGA
AA sequence Show only first row Show all	>Potri.011G094200.3 pacid=42780458 polypeptide=Potri.011G094200.3.p locus=Potri.011G094200 ID=Potri.011G094200.3.v4.1 annot-version=v4.1 MIEYRQAHLKSISHCLSLQKAHSVYLSLSVNRFPASPESLSLEFMSDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGQPESPGKVVDSHVKPG LNPAKSQPKKWFCCIQSPHVES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G55850		NOI	RPM1-interacting protein 4 (RI...		Potri.011G094200 [exp]	0	1
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Potri.002G018700 [exp]	2.44	0.8070	Pt-SKP1.2
AT2G04520			Nucleic acid-binding, OB-fold-...		Potri.014G160900 [exp]	3.74	0.8016
AT3G52560		MMZ4 ,UEV1D ,UE...	MMS2 ZWEI HOMOLOGUE 4, ubiquit...		Potri.006G205700 [exp]	7.74	0.7224
AT1G15880		ATGOS11, GOS11	golgi snare 11 (.1)		Potri.003G180800 [exp]	7.74	0.7601	GOS11.2
AT5G52200		AtI-2	inhibitor-2, phosphoprotein ph...		Potri.015G140500 [exp]	7.87	0.7222
AT4G37608			unknown protein		Potri.009G004400 [exp]	9.64	0.7995
AT1G20460			unknown protein		Potri.002G013000 [exp]	9.89	0.7451
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.008G168000 [exp]	10.39	0.7704
AT1G61780			postsynaptic protein-related (...		Potri.004G021200 [exp]	13.26	0.7560
AT3G55380		UBC14	ubiquitin-conjugating enzyme 1...		Potri.008G053900 [exp]	13.78	0.7798	Pt-UBC7.1

Compare expression of checked genes

Potri.011G094200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.