Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46030 146 / 4e-47 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G373400 [exp] 181 / 3e-61 AT5G46030 122 / 1e-37 unknown protein Potri.014G056000 [exp] 89 / 4e-25 AT5G46030 92 / 1e-25 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015293 [exp] 167 / 1e-52 AT5G46030 154 / 2e-46 unknown protein Lus10025438 [exp] 136 / 2e-43 AT5G46030 127 / 8e-40 unknown protein Lus10014995 [exp] 74 / 1e-18 AT5G46030 74 / 6e-18 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF05129 [poplar] [flax] Elf1 Transcription elongation factor Elf1 like
Representative CDS sequence Show only first row Show all	>Potri.011G097300.3 pacid=42780869 polypeptide=Potri.011G097300.3.p locus=Potri.011G097300 ID=Potri.011G097300.3.v4.1 annot-version=v4.1 ATGGGGAAAAGAAAGTCAACAGCAAAGCCACCACCCAAGAAGCGGATGGACAAGCTTGATACTGTTTTTAGTTGCCCTTTCTGCAACCATGGCACAAGTG TCGAATGTCGCATTGATATGAAGAACTTGATTGGTGAGGCTGTATGTGGGATTTGCCAGGAGAGCTTCAGCATGACCATCACAGCTTTGACTGAGCCTAT AGACATATATAGCGAATGGATTGATGAATGCGAAAGGGTCAACAGCCTGGAAGATGACGGTGCTTAA
AA sequence Show only first row Show all	>Potri.011G097300.3 pacid=42780869 polypeptide=Potri.011G097300.3.p locus=Potri.011G097300 ID=Potri.011G097300.3.v4.1 annot-version=v4.1 MGKRKSTAKPPPKKRMDKLDTVFSCPFCNHGTSVECRIDMKNLIGEAVCGICQESFSMTITALTEPIDIYSEWIDECERVNSLEDDGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46030			unknown protein		Potri.011G097300 [exp]	0	1
AT4G35040	bZIP	bZIP19	Basic-leucine zipper (bZIP) tr...		Potri.004G175200 [exp]	1.00	0.9279
AT3G05700			Drought-responsive family prot...		Potri.013G011200 [exp]	1.41	0.9273
AT4G09830			Uncharacterised conserved prot...		Potri.005G196400 [exp]	3.74	0.8571
AT5G59180		NRPB7	DNA-directed RNA polymerase II...		Potri.001G377200 [exp]	3.87	0.8677	RPB19.1
AT3G16640		TCTP	translationally controlled tum...		Potri.010G013400 [exp]	4.47	0.8685	Pt-TCTP.2
AT3G18165		MOS4	modifier of snc1,4 (.1)		Potri.015G041800 [exp]	4.89	0.8494
AT1G71750		HGPT	Hypoxanthine-guanine phosphori...		Potri.005G198400 [exp]	6.70	0.8538
AT1G31335			unknown protein		Potri.006G127000 [exp]	8.12	0.8591
AT4G19140			unknown protein		Potri.001G130900 [exp]	8.77	0.8499
AT4G21110			G10 family protein (.1)		Potri.009G147000 [exp]	11.83	0.8150

Compare expression of checked genes

Potri.011G097300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.