Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78520 133 / 4e-42 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G43670 119 / 1e-36 Carbohydrate-binding X8 domain superfamily protein (.1) AT3G28250 103 / 5e-30 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09462 93 / 5e-26 Carbohydrate-binding X8 domain superfamily protein (.1) AT5G53600 92 / 1e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09467 91 / 3e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09464 91 / 3e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09465 91 / 4e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G66870 90 / 7e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G43660 90 / 8e-25 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G380600 [exp] 171 / 6e-57 AT1G78520 145 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G101451 [exp] 166 / 3e-55 AT1G78520 124 / 2e-38 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G099600 [exp] 161 / 4e-53 AT1G78520 127 / 6e-39 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G101351 [exp] 159 / 2e-52 AT1G78520 126 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G351600 [exp] 122 / 1e-37 AT1G78520 119 / 9e-36 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.014G114500 [exp] 92 / 1e-25 AT1G66870 96 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.002G007300 [exp] 96 / 1e-24 AT4G29360 339 / 1e-111 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.001G240000 [exp] 95 / 2e-24 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.004G153800 [exp] 90 / 1e-22 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042492 [exp] 141 / 4e-45 AT1G78520 127 / 3e-39 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10026175 [exp] 127 / 4e-38 AT1G78520 114 / 2e-32 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10016539 [exp] 96 / 9e-25 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040808 [exp] 93 / 1e-23 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040461 [exp] 91 / 4e-23 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10023576 [exp] 89 / 3e-22 AT2G16230 644 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10004962 [exp] 87 / 2e-21 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10005459 [exp] 85 / 3e-21 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10039923 [exp] 82 / 4e-21 AT4G34480 93 / 5e-25 O-Glycosyl hydrolases family 17 protein (.1) Lus10034607 [exp] 84 / 2e-20 AT2G01630 691 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [poplar] [flax] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Potri.011G099000.2 pacid=42781639 polypeptide=Potri.011G099000.2.p locus=Potri.011G099000 ID=Potri.011G099000.2.v4.1 annot-version=v4.1 CAGAGAACTTGGTGTGTGGCCAAGCCATCGTCGGATCAAGCAACTTTACTAGCGAATATCAATTACGCATGCTCTCACGTGGATTGCCAGATTCTACAAA AGGGTTACCCTTGCTTTTCTCCGGATAGTCTCATAAGCCATGCATCAATAGCCATGAATCTGTACTACCAACGTAAGGGAAGGAACCACTGGAATTGTGA TTTCAGGGACTCTGGCCTCATTGTCAAGACTGATCCAAGCTATAGCAACTGCATCTATGCCTAA
AA sequence Show only first row Show all	>Potri.011G099000.2 pacid=42781639 polypeptide=Potri.011G099000.2.p locus=Potri.011G099000 ID=Potri.011G099000.2.v4.1 annot-version=v4.1 QRTWCVAKPSSDQATLLANINYACSHVDCQILQKGYPCFSPDSLISHASIAMNLYYQRKGRNHWNCDFRDSGLIVKTDPSYSNCIYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78520			Carbohydrate-binding X8 domain...		Potri.011G099000 [exp]	0	1
AT3G04690		ANX1	ANXUR1, Malectin/receptor-like...		Potri.010G145600 [exp]	19.49	0.7763
AT4G33870			Peroxidase superfamily protein...		Potri.003G053700 [exp]	26.21	0.7708
AT5G26250			Major facilitator superfamily ...		Potri.010G090000 [exp]	89.54	0.6978
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G109300 [exp]	102.46	0.7226

Compare expression of checked genes

Potri.011G099000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.