Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14610 195 / 4e-61 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14680 195 / 4e-61 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14630 192 / 3e-60 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14690 191 / 1e-59 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14660 191 / 2e-59 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14640 187 / 3e-58 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14650 185 / 2e-57 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14620 179 / 4e-55 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT1G17060 157 / 8e-47 SHK1, CHI2, SOB7, CYP72C1 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) AT2G26710 138 / 2e-39 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G099701 [exp] 248 / 8e-87 AT3G14630 189 / 5e-59 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Potri.011G098800 [exp] 258 / 2e-85 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101700 [exp] 256 / 5e-85 AT3G14690 606 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099800 [exp] 255 / 2e-84 AT3G14690 612 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101401 [exp] 255 / 2e-84 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099400 [exp] 255 / 2e-84 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099200 [exp] 250 / 2e-84 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G101500 [exp] 255 / 3e-84 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101250 [exp] 224 / 2e-72 AT3G14690 568 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042487 [exp] 184 / 1e-56 AT3G14690 604 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10026178 [exp] 177 / 3e-54 AT3G14690 607 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10042486 [exp] 177 / 4e-54 AT3G14690 580 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10026179 [exp] 143 / 2e-45 AT3G14620 152 / 4e-45 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10026084 [exp] 145 / 3e-42 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10025756 [exp] 143 / 2e-41 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10017775 [exp] 144 / 3e-41 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10010802 [exp] 139 / 3e-41 AT1G75130 432 / 6e-150 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10025755 [exp] 144 / 6e-41 AT1G80300 923 / 0.0 nucleotide transporter 1 (.1) Lus10010800 [exp] 132 / 4e-40 AT1G75130 211 / 2e-66 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.011G101750.1 pacid=42781817 polypeptide=Potri.011G101750.1.p locus=Potri.011G101750 ID=Potri.011G101750.1.v4.1 annot-version=v4.1 ATGCTTAATCGAGATGTTCATGAAGAAATAAAGCTTGGAAATTTGCTATTACCTGCCGGAGTGCAGATCTCGTTGCCAACAATCCTCCTTCACCAAGATC ATGAACTTTGGGGTGATGATGCCTCTGAGTTCAAACCAGAGAGGTTTGCTGAAGGTGTTTCAAAGGCAACAAAGAGTCAAGTCTCATTCCTTCCATTTGG ATGGGGTCCTCGAATATGCGTTGGACAAAACTTTGCTTTGATTGAAGCAAAAATGGCTTTGGCAATGGTTTTACAGCGCTGCTCTTTTGAGCTCTCTCCG TCGTATATTCATGCTCCTCGCACAGTCATAACTCTTCAGCCACAGCACGGTGCTCCAATGATATTACGTAAACTCTAA
AA sequence Show only first row Show all	>Potri.011G101750.1 pacid=42781817 polypeptide=Potri.011G101750.1.p locus=Potri.011G101750 ID=Potri.011G101750.1.v4.1 annot-version=v4.1 MLNRDVHEEIKLGNLLLPAGVQISLPTILLHQDHELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAMVLQRCSFELSP SYIHAPRTVITLQPQHGAPMILRKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14680		CYP72A14	"cytochrome P450, family 72, s...		Potri.011G101750 [exp]	0	1
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Potri.011G101700 [exp]	1.41	0.8330
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Potri.011G099701 [exp]	2.44	0.8092
AT2G41905			unknown protein		Potri.009G063600 [exp]	9.32	0.7079
AT5G51400			PLAC8 family protein (.1)		Potri.003G108800 [exp]	9.38	0.7467
AT5G18020			SAUR-like auxin-responsive pro...		Potri.004G166300 [exp]	9.94	0.7716
AT2G17080			Arabidopsis protein of unknown...		Potri.005G249100 [exp]	21.49	0.7310
AT1G53400			Ubiquitin domain-containing pr...		Potri.001G387400 [exp]	22.71	0.7679
					Potri.002G093800 [exp]	23.36	0.6961
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.001G063709 [exp]	28.19	0.7582
AT3G07550			RNI-like superfamily protein (...		Potri.017G056400 [exp]	28.46	0.7078

Compare expression of checked genes

Potri.011G101750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.