Potri.011G101900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78530 210 / 2e-68 Protein kinase superfamily protein (.1)
AT1G31420 143 / 9e-41 FEI1 FEI 1, Leucine-rich repeat protein kinase family protein (.1.2)
AT2G35620 135 / 5e-38 FEI2 FEI 2, Leucine-rich repeat protein kinase family protein (.1.2)
AT5G62710 127 / 5e-35 Leucine-rich repeat protein kinase family protein (.1)
AT3G59110 122 / 3e-33 Protein kinase superfamily protein (.1)
AT1G09440 119 / 2e-32 Protein kinase superfamily protein (.1)
AT1G56720 119 / 2e-32 Protein kinase superfamily protein (.1.2.3)
AT3G09010 115 / 3e-31 Protein kinase superfamily protein (.1)
AT1G01540 115 / 4e-31 Protein kinase superfamily protein (.1.2)
AT4G02010 116 / 6e-31 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G380800 255 / 6e-86 AT1G78530 535 / 0.0 Protein kinase superfamily protein (.1)
Potri.001G129000 130 / 3e-36 AT1G31420 928 / 0.0 FEI 1, Leucine-rich repeat protein kinase family protein (.1.2)
Potri.012G071100 128 / 2e-35 AT5G62710 943 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.003G105000 127 / 5e-35 AT1G31420 893 / 0.0 FEI 1, Leucine-rich repeat protein kinase family protein (.1.2)
Potri.005G003300 121 / 4e-33 AT1G56720 712 / 0.0 Protein kinase superfamily protein (.1.2.3)
Potri.010G001600 121 / 4e-33 AT5G18500 635 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G472900 120 / 2e-32 AT1G55610 1485 / 0.0 BRI1 like (.1.2)
Potri.013G003700 119 / 3e-32 AT1G56720 677 / 0.0 Protein kinase superfamily protein (.1.2.3)
Potri.005G203300 119 / 3e-32 AT3G59110 686 / 0.0 Protein kinase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005569 206 / 3e-67 AT1G78530 462 / 2e-164 Protein kinase superfamily protein (.1)
Lus10034753 134 / 2e-37 AT1G31420 893 / 0.0 FEI 1, Leucine-rich repeat protein kinase family protein (.1.2)
Lus10033104 130 / 4e-36 AT5G62710 934 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10036672 128 / 3e-35 AT5G62710 936 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10020747 123 / 7e-34 AT3G59110 737 / 0.0 Protein kinase superfamily protein (.1)
Lus10006215 122 / 2e-33 AT1G56720 599 / 0.0 Protein kinase superfamily protein (.1.2.3)
Lus10029788 121 / 5e-33 AT3G59110 734 / 0.0 Protein kinase superfamily protein (.1)
Lus10038087 119 / 1e-32 AT5G15080 499 / 6e-175 Protein kinase superfamily protein (.1)
Lus10025358 116 / 2e-32 AT4G33430 500 / 2e-176 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2)
Lus10006643 118 / 3e-32 AT5G15080 495 / 2e-173 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Potri.011G101900.1 pacid=42781618 polypeptide=Potri.011G101900.1.p locus=Potri.011G101900 ID=Potri.011G101900.1.v4.1 annot-version=v4.1
ATGGAAGCTCGAGTTTCTGATCTCGGATTGGCCACATTGATGGAACCTAATAAGACTCATGTTTCAACATTAGTAGCGGGAACTTCTGGATACTTGGCTC
CTGAGTACTTTGAAACAGGGAAAGTGACCGTGAAAGTGGATGTATACAGCTTTGGAGTTGTCCTGCTCGAACTTCTAACTGGAATGAAGCCAACAGATGA
AGAATTTTTCGAGGAAGGAACCAAGCTTGTAACATGGGTGAAGGCAATTGTTGAAGATAAAAGGGAAGAGTATGTCCTTGACAGTAGCTTAAAGTGCAGT
CCCACTGAAGAGATAAATAAAGTATTCAGAATAGCATTCATGTGCCTTGAACCAGAGCCCTCCAAGAGACCTACCATGGATGAGATTGTCAAGATGCTTG
AGCGAGCTAAATCGGAGAGGGTTGTGTAA
AA sequence
>Potri.011G101900.1 pacid=42781618 polypeptide=Potri.011G101900.1.p locus=Potri.011G101900 ID=Potri.011G101900.1.v4.1 annot-version=v4.1
MEARVSDLGLATLMEPNKTHVSTLVAGTSGYLAPEYFETGKVTVKVDVYSFGVVLLELLTGMKPTDEEFFEEGTKLVTWVKAIVEDKREEYVLDSSLKCS
PTEEINKVFRIAFMCLEPEPSKRPTMDEIVKMLERAKSERVV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G78530 Protein kinase superfamily pro... Potri.011G101900 0 1
AT5G02920 F-box/RNI-like superfamily pro... Potri.017G146500 7.87 0.9033
Potri.001G343300 11.00 0.8171
AT4G27640 ARM repeat superfamily protein... Potri.010G169800 11.61 0.8082
AT4G19550 zinc ion binding;transcription... Potri.001G082800 13.92 0.8305
AT3G56860 UBA2A UBP1-associated protein 2A (.1... Potri.012G109100 18.43 0.7833
AT4G18230 unknown protein Potri.002G170700 20.42 0.8931
AT1G69680 Mog1/PsbP/DUF1795-like photosy... Potri.013G049900 22.27 0.8927
AT2G38480 Uncharacterised protein family... Potri.016G128200 27.49 0.8236
AT5G67500 VDAC2, ATVDAC2 ARABIDOPSIS THALIANA VOLTAGE D... Potri.001G294000 28.54 0.7890
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Potri.001G335800 29.49 0.8712 GAPDH.2

Potri.011G101900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.