Potri.011G103301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15530 53 / 1e-08 RING/U-box superfamily protein (.1.2.3.4)
AT3G13857 36 / 0.0007 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G103401 117 / 8e-35 AT2G15530 51 / 8e-09 RING/U-box superfamily protein (.1.2.3.4)
Potri.005G055667 72 / 3e-17 AT2G15530 52 / 3e-09 RING/U-box superfamily protein (.1.2.3.4)
Potri.005G055534 69 / 1e-15 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G103301.1 pacid=42780848 polypeptide=Potri.011G103301.1.p locus=Potri.011G103301 ID=Potri.011G103301.1.v4.1 annot-version=v4.1
ATGGCCTTCTATCTAGCCAAAAAATGTGACCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTTTCAAAGCAAGTGCTTAGAAAAGCAGCAAATCCTCGGCC
ATGGCACCCACCTTTCCAACAACAGCAGCAAGTTACAGCTTCACCTTTCTTCAGCGTCTCTCTCATCTTCTCAACCTTTGTATACGCGACGCAGAGAAGA
AAAGCTTGTCCCTTCGGGGACATCCGATAAAATTGGAACGATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGGT
CCAAATTTTTTTGTTTTTTTCAGTCTCTGCTCTTCTGCTTGCTTGCTTCAGTGGCTCCCTTTCTCATCTGGGTTCTTTAGAAGCACACATATTGTCATCT
TATTCTATGTTCAGTGGCAGCGAGGATGCTCACTGTCTTTGAAGGCCCTACAACATGTAGAGAGAAGATATTAA
AA sequence
>Potri.011G103301.1 pacid=42780848 polypeptide=Potri.011G103301.1.p locus=Potri.011G103301 ID=Potri.011G103301.1.v4.1 annot-version=v4.1
MAFYLAKKCDPLSLSLSLSLFQSKCLEKQQILGHGTHLSNNSSKLQLHLSSASLSSSQPLYTRRREEKLVPSGTSDKIGTIQRRLAWPLRKDDTHKSRNG
PNFFVFFSLCSSACLLQWLPFSSGFFRSTHIVILFYVQWQRGCSLSLKALQHVERRY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G15530 RING/U-box superfamily protein... Potri.011G103301 0 1
AT5G08305 Pentatricopeptide repeat (PPR)... Potri.007G073100 6.24 0.9068
AT5G61370 Pentatricopeptide repeat (PPR)... Potri.012G068400 6.63 0.9153
AT1G43760 DNAse I-like superfamily prote... Potri.002G000402 8.83 0.8829
AT2G22070 pentatricopeptide (PPR) repeat... Potri.007G085500 8.94 0.9046
AT5G13270 RARE1 REQUIRED FOR ACCD RNA EDITING ... Potri.003G163701 15.09 0.8864
Potri.006G080001 15.55 0.8155
AT4G12710 ARM repeat superfamily protein... Potri.014G170100 17.32 0.8651
AT1G69350 Tetratricopeptide repeat (TPR)... Potri.008G093000 19.33 0.8870
AT5G06540 Pentatricopeptide repeat (PPR)... Potri.016G065500 19.39 0.8878
AT3G22690 unknown protein Potri.006G245300 20.83 0.8965

Potri.011G103301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.