Plant FIBer expression Database

Potri.011G103401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15530 52 / 2e-09 RING/U-box superfamily protein (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G103301
[exp]
86 / 1e-22 AT2G15530 52 / 4e-08 RING/U-box superfamily protein (.1.2.3.4)
Potri.005G055667
[exp]
74 / 5e-19 AT2G15530 52 / 3e-09 RING/U-box superfamily protein (.1.2.3.4)
Potri.005G055534
[exp]
69 / 2e-16 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2)
Potri.001G382700
[exp]
40 / 4e-05 AT3G14750 297 / 6e-100 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.011G103401.1 pacid=42781997 polypeptide=Potri.011G103401.1.p locus=Potri.011G103401 ID=Potri.011G103401.1.v4.1 annot-version=v4.1
ATGAAGCTCATTCCGCGTAGTTTTCACCCCACGAAGATCCATCTCCATCCGCTCAAATATTTAATTTCCCTACGGATGGTGACGGGATCAAGAGATCTGA
AGCTTGTCCCTTCGGGGACATCCGATAAAATTGGAACGATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGGTCC
AAATTTTTTTTTGTTTTTTTTCAGTCTCTGCTCTTCTGCTTGCTTGCTTCAATGGCTCCCTTTCTCATCT
AA sequence
>Potri.011G103401.1 pacid=42781997 polypeptide=Potri.011G103401.1.p locus=Potri.011G103401 ID=Potri.011G103401.1.v4.1 annot-version=v4.1
MKLIPRSFHPTKIHLHPLKYLISLRMVTGSRDLKLVPSGTSDKIGTIQRRLAWPLRKDDTHKSRNGPNFFLFFFSLCSSACLLQWLPFSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G15530 RING/U-box superfamily protein... Potri.011G103401
[exp]
0 1
Potri.001G276104
[exp]
7.34 0.6280
Potri.015G106750
[exp]
13.19 0.6130
AT3G04280 ARR22 response regulator 22 (.1.2.3) Potri.003G172750
[exp]
16.12 0.5405
AT5G34885 Protein of unknown function (D... Potri.004G109232
[exp]
17.54 0.5892
Potri.014G107050
[exp]
21.21 0.5180
AT2G33100 ATCSLD1 CELLULOSE-SYNTHASE LIKE D1, ce... Potri.001G050200
[exp]
53.21 0.4527 Pt-ATCSLD1.2
Potri.008G036350
[exp]
57.70 0.4748
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Potri.008G049801
[exp]
59.96 0.4505

Potri.011G103401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.