Potri.011G106100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78630 342 / 3e-120 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
AT3G01790 82 / 4e-19 Ribosomal protein L13 family protein (.1.2)
AT5G48760 47 / 2e-06 Ribosomal protein L13 family protein (.1.2)
AT3G24830 47 / 2e-06 Ribosomal protein L13 family protein (.1)
AT3G07110 46 / 5e-06 Ribosomal protein L13 family protein (.1.2)
AT4G13170 45 / 1e-05 Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G384600 387 / 5e-138 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.001G334000 85 / 4e-20 AT3G01790 299 / 2e-104 Ribosomal protein L13 family protein (.1.2)
Potri.017G066000 85 / 5e-20 AT3G01790 266 / 3e-91 Ribosomal protein L13 family protein (.1.2)
Potri.017G054600 50 / 3e-07 AT5G48760 351 / 5e-125 Ribosomal protein L13 family protein (.1.2)
Potri.002G242600 49 / 4e-07 AT4G13170 357 / 4e-127 Ribosomal protein L13 family protein (.1)
Potri.001G314500 49 / 5e-07 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005553 331 / 2e-115 AT1G78630 332 / 8e-116 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Lus10041940 314 / 8e-109 AT1G78630 317 / 4e-110 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Lus10014597 82 / 7e-19 AT3G01790 309 / 3e-108 Ribosomal protein L13 family protein (.1.2)
Lus10032063 81 / 4e-18 AT3G01790 308 / 3e-107 Ribosomal protein L13 family protein (.1.2)
Lus10032599 49 / 5e-07 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10043151 49 / 5e-07 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10016679 49 / 5e-07 AT5G48760 386 / 9e-139 Ribosomal protein L13 family protein (.1.2)
Lus10007137 49 / 5e-07 AT5G48760 384 / 6e-138 Ribosomal protein L13 family protein (.1.2)
Lus10011857 48 / 1e-06 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10022793 48 / 1e-06 AT5G48760 390 / 2e-140 Ribosomal protein L13 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Potri.011G106100.1 pacid=42781584 polypeptide=Potri.011G106100.1.p locus=Potri.011G106100 ID=Potri.011G106100.1.v4.1 annot-version=v4.1
ATGGCAATGCTTTGTGCCTCATCTTCTTTTACTACTTCAACAAAACCCTCTTCTTCTTACTCAACAAAGAATGGAACTAGTATTAGTCCCAGCCCTTTTG
TTGTTGGGTTCTCTTTTTCACAGTCATGGTTTTCTTTGAGTAATAGCAGGCGTGGTTTCGAGGTTCGGTGCGAGAAGAAAGACAAGAGCGTCGCCACTCG
CGTTCCTCTTGACCAACGCTGGTTGTTTGAAGAATCTGAAATTAATGGCCCTGATATTTGGAATACGACATGGTATCCTAAAGCTGCAGATCATATTAAC
ACAGAGAAAACTTGGTACATTGTTGATGCAACTGACAAGATTCTTGGAAGACTGGCATCAACAATTGCCATTTACGTTCGTGGAAAGAATTTGGCCACTT
ACACTCCTAGTGTGGACATGGGGGCTTTTGTGATTGTGGTAAATGCTGAGAAAGTTGCTGTATCTGGTAAGAAGAGGACCCAAAAGTTATACAGGAGGCA
TTCAGGAAGACCAGGCGGTATGACAGTGGAGACATTTGATCAGCTACAACAGAGGATTCCAGAAAGAATTATTGAACATGCTGTTCGTGGTATGCTTCCT
AAAGGAAGGCTTGGCAGAGCATTGTTCAACCACCTTAAGGTTTACACAGGCCCAATTCATCCGCATGAGGCTCAGAAGCCAATTGAGCTGCCGATAAGGG
ACAAAAGAATACAGATGGAGAGATAG
AA sequence
>Potri.011G106100.1 pacid=42781584 polypeptide=Potri.011G106100.1.p locus=Potri.011G106100 ID=Potri.011G106100.1.v4.1 annot-version=v4.1
MAMLCASSSFTTSTKPSSSYSTKNGTSISPSPFVVGFSFSQSWFSLSNSRRGFEVRCEKKDKSVATRVPLDQRWLFEESEINGPDIWNTTWYPKAADHIN
TEKTWYIVDATDKILGRLASTIAIYVRGKNLATYTPSVDMGAFVIVVNAEKVAVSGKKRTQKLYRRHSGRPGGMTVETFDQLQQRIPERIIEHAVRGMLP
KGRLGRALFNHLKVYTGPIHPHEAQKPIELPIRDKRIQMER

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Potri.011G106100 0 1
AT5G58250 EMB3143 EMBRYO DEFECTIVE 3143, unknown... Potri.013G161000 2.44 0.9660
AT1G52220 unknown protein Potri.001G184700 4.69 0.9645
AT4G33030 SQD1 sulfoquinovosyldiacylglycerol ... Potri.006G228000 5.29 0.9580
AT3G48730 GSA2 glutamate-1-semialdehyde 2,1-a... Potri.015G101100 6.48 0.9476 Pt-GSA1.1
AT1G35680 RPL21C chloroplast ribosomal protein ... Potri.019G083400 8.66 0.9611 Pt-RPL21.3
AT2G20725 CAAX amino terminal protease f... Potri.019G101100 10.58 0.9337
AT5G66470 RNA binding;GTP binding (.1) Potri.007G021900 12.96 0.9459
AT4G31990 AAT3, ATAAT1, A... ASPARTATE AMINOTRANSFERASE DEF... Potri.018G022200 13.22 0.9458 Pt-AAT2.2
AT3G56940 CRD1, CHL27, AC... COPPER RESPONSE DEFECT 1, dica... Potri.016G025000 13.56 0.9533 AT103.1
AT3G57190 PrfB3 peptide chain release factor 3... Potri.006G045200 16.97 0.9300

Potri.011G106100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.