Potri.011G108101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29290 44 / 4e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G393101 111 / 7e-34 AT1G29290 45 / 1e-07 unknown protein
Potri.004G061300 44 / 5e-07 AT1G29290 71 / 3e-17 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G108101.1 pacid=42781358 polypeptide=Potri.011G108101.1.p locus=Potri.011G108101 ID=Potri.011G108101.1.v4.1 annot-version=v4.1
ATGGCTCGTCTAAGCACAATGGCATTCATCTTCATACTCATTTTGATTTGTCATGCACCGTCTTTTGAAGCCAGAAAGTTACTGAGCCTGGAGAAGAAAG
AAAATCCTGCTTTGGAAGACAAGTTTATACCATCTTTTCCCCCTGTTCGTGATGCGCAATCAATAGTCATCGGTAAAAGGTTCATCACGCCCCAACTGTC
CAAAATCGATCGAATTTTGCAGTCCGTCCCCAGTCCTGGAGCAGGAAACTAG
AA sequence
>Potri.011G108101.1 pacid=42781358 polypeptide=Potri.011G108101.1.p locus=Potri.011G108101 ID=Potri.011G108101.1.v4.1 annot-version=v4.1
MARLSTMAFIFILILICHAPSFEARKLLSLEKKENPALEDKFIPSFPPVRDAQSIVIGKRFITPQLSKIDRILQSVPSPGAGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G29290 unknown protein Potri.011G108101 0 1
AT5G56170 LLG1 LORELEI-LIKE-GPI-ANCHORED PROT... Potri.019G095200 2.44 0.8093
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Potri.003G218000 9.48 0.7977
AT1G55790 Domain of unknown function (DU... Potri.011G141700 10.95 0.7883
Potri.001G443025 11.31 0.7775
AT5G51330 DYAD, SWI1 SWITCH1 (.1) Potri.001G126901 12.96 0.7405
AT1G34670 MYB ATMYB93 myb domain protein 93 (.1) Potri.007G093900 13.03 0.7531
AT4G02390 ATPARP1, APP POLY\(ADP-RIBOSE\) POLYMERASE ... Potri.009G136501 14.69 0.7048
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.006G137100 16.88 0.7236
AT2G47160 AtBOR1, BOR1 REQUIRES HIGH BORON 1, HCO3- t... Potri.002G191000 20.14 0.6772
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Potri.001G048200 20.19 0.7325

Potri.011G108101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.