Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58680 240 / 3e-83 MBF1B, ATMBF1B multiprotein bridging factor 1B (.1) AT2G42680 239 / 1e-82 MBF1A, ATMBF1A ARABIDOPSIS THALIANA MULTIPROTEIN BRIDGING FACTOR 1A, multiprotein bridging factor 1A (.1) AT3G24500 143 / 1e-44 MBF1C, ATMBF1C multiprotein bridging factor 1C (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G390400 [exp] 243 / 2e-84 AT3G58680 242 / 6e-84 multiprotein bridging factor 1B (.1) Potri.018G075200 [exp] 154 / 5e-49 AT3G24500 223 / 4e-76 multiprotein bridging factor 1C (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013686 [exp] 251 / 2e-87 AT3G58680 224 / 5e-77 multiprotein bridging factor 1B (.1) Lus10017945 [exp] 251 / 2e-87 AT3G58680 224 / 5e-77 multiprotein bridging factor 1B (.1) Lus10034592 [exp] 150 / 2e-47 AT3G24500 201 / 1e-67 multiprotein bridging factor 1C (.1.2) Lus10021776 [exp] 147 / 2e-46 AT3G24500 202 / 8e-68 multiprotein bridging factor 1C (.1.2) Lus10000056 [exp] 107 / 2e-31 AT2G42680 100 / 3e-29 ARABIDOPSIS THALIANA MULTIPROTEIN BRIDGING FACTOR 1A, multiprotein bridging factor 1A (.1) Lus10016756 [exp] 48 / 8e-08 AT3G24500 65 / 5e-15 multiprotein bridging factor 1C (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF01381 [poplar] [flax] HTH_3 Helix-turn-helix CL0123 [poplar] [flax] PF08523 [poplar] [flax] MBF1 Multiprotein bridging factor 1
Representative CDS sequence Show only first row Show all	>Potri.011G109500.1 pacid=42780509 polypeptide=Potri.011G109500.1.p locus=Potri.011G109500 ID=Potri.011G109500.1.v4.1 annot-version=v4.1 ATGTCAGGACCAATCTCACAGGACTGGGAGCCGGTGGTGATCCGTAAGAAAGCTCCCAACGCCGCCGCCAAGAAGGATGAGAAGGCCGTCAACGCCGCCC GCCGCGCTGGTGCTGAGATCGAAACCGTCAAAAAATCAACTGCTGGTACAAACAAGGCCGCTTCTAGCAGCACTTCTTTGAACACAAGGAAGCTCGATGA CGAAACAGAGAACCTTACTCATGACCGAGTGCCAACTGAACTGAAGAAAGCAATTATGCAGGCTAGAATGGACAAGAAACTTACCCAGGCTCAACTTGCA CAGGTGATCAATGAGAAGCCCCAGATAATTCAGGAGTATGAATCTGGAAAAGCCATTCCTAATCAGCAGATTATAGGAAAACTGGAGAGGGCTCTTGGTG TGAAGCTACGGGGAAAGAAGTAG
AA sequence Show only first row Show all	>Potri.011G109500.1 pacid=42780509 polypeptide=Potri.011G109500.1.p locus=Potri.011G109500 ID=Potri.011G109500.1.v4.1 annot-version=v4.1 MSGPISQDWEPVVIRKKAPNAAAKKDEKAVNAARRAGAEIETVKKSTAGTNKAASSSTSLNTRKLDDETENLTHDRVPTELKKAIMQARMDKKLTQAQLA QVINEKPQIIQEYESGKAIPNQQIIGKLERALGVKLRGKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Potri.011G109500 [exp]	0	1
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Potri.005G243100 [exp]	1.41	0.7622	Pt-SKP1.3
AT2G36300			Integral membrane Yip1 family ...		Potri.009G152600 [exp]	6.70	0.7124
AT3G55600			Membrane fusion protein Use1 (...		Potri.018G133700 [exp]	8.00	0.6648
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Potri.001G236900 [exp]	8.48	0.7308
AT1G76860			Small nuclear ribonucleoprotei...		Potri.005G191600 [exp]	9.38	0.7162
AT5G22280			unknown protein		Potri.016G073500 [exp]	12.84	0.7181
AT2G27960		CKS1AT, CKS1	cyclin-dependent kinase-subuni...		Potri.009G004000 [exp]	20.71	0.6676
AT3G11780			MD-2-related lipid recognition...		Potri.016G067800 [exp]	21.56	0.6363
AT1G08580			unknown protein		Potri.019G049300 [exp]	25.21	0.6961
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.001G374000 [exp]	26.98	0.6675	RAB11.4

Compare expression of checked genes

Potri.011G109500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.