Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42610 239 / 8e-82 LSH10 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) AT1G78815 237 / 2e-80 LSH7 LIGHT SENSITIVE HYPOCOTYLS 7, Protein of unknown function (DUF640) (.1) AT4G18610 219 / 1e-73 LSH9 LIGHT SENSITIVE HYPOCOTYLS 9, Protein of unknown function (DUF640) (.1) AT1G16910 218 / 2e-73 LSH8 LIGHT SENSITIVE HYPOCOTYLS 8, Protein of unknown function (DUF640) (.1) AT1G07090 219 / 3e-73 LSH6 LIGHT SENSITIVE HYPOCOTYLS 6, Protein of unknown function (DUF640) (.1) AT5G58500 208 / 2e-69 LSH5 LIGHT SENSITIVE HYPOCOTYLS 5, Protein of unknown function (DUF640) (.1) AT3G23290 197 / 8e-65 LSH4 LIGHT SENSITIVE HYPOCOTYLS 4, Protein of unknown function (DUF640) (.2) AT5G28490 192 / 7e-63 OBO2, LSH1 ORGAN BOUNDARY 2, LIGHT-DEPENDENT SHORT HYPOCOTYLS 1, Protein of unknown function (DUF640) (.1) AT2G31160 189 / 3e-61 OBO1, LSH3 ORGAN BOUNDARY 1, LIGHT SENSITIVE HYPOCOTYLS 3, Protein of unknown function (DUF640) (.1) AT3G04510 187 / 1e-60 LSH2 LIGHT SENSITIVE HYPOCOTYLS 2, Protein of unknown function (DUF640) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G390900 [exp] 337 / 2e-120 AT1G78815 242 / 2e-82 LIGHT SENSITIVE HYPOCOTYLS 7, Protein of unknown function (DUF640) (.1) Potri.014G142400 [exp] 266 / 3e-92 AT2G42610 259 / 1e-89 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Potri.002G214200 [exp] 263 / 5e-91 AT2G42610 240 / 5e-82 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Potri.004G057300 [exp] 255 / 7e-88 AT2G42610 241 / 2e-82 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Potri.011G066400 [exp] 251 / 2e-86 AT2G42610 238 / 5e-81 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Potri.009G076100 [exp] 219 / 3e-73 AT1G07090 259 / 2e-88 LIGHT SENSITIVE HYPOCOTYLS 6, Protein of unknown function (DUF640) (.1) Potri.001G281000 [exp] 216 / 9e-72 AT1G07090 251 / 4e-85 LIGHT SENSITIVE HYPOCOTYLS 6, Protein of unknown function (DUF640) (.1) Potri.009G157600 [exp] 199 / 1e-65 AT5G28490 228 / 7e-77 ORGAN BOUNDARY 2, LIGHT-DEPENDENT SHORT HYPOCOTYLS 1, Protein of unknown function (DUF640) (.1) Potri.011G156600 [exp] 200 / 2e-65 AT3G23290 205 / 7e-67 LIGHT SENSITIVE HYPOCOTYLS 4, Protein of unknown function (DUF640) (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029838 [exp] 250 / 2e-85 AT2G42610 261 / 3e-90 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Lus10020700 [exp] 245 / 1e-83 AT2G42610 258 / 1e-88 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Lus10029219 [exp] 236 / 4e-80 AT2G42610 238 / 6e-81 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Lus10007272 [exp] 235 / 9e-80 AT2G42610 241 / 4e-82 LIGHT SENSITIVE HYPOCOTYLS 10, Protein of unknown function (DUF640) (.1), Protein of unknown function (DUF640) (.2) Lus10022023 [exp] 198 / 3e-65 AT1G07090 226 / 3e-76 LIGHT SENSITIVE HYPOCOTYLS 6, Protein of unknown function (DUF640) (.1) Lus10023383 [exp] 198 / 6e-65 AT1G07090 246 / 2e-83 LIGHT SENSITIVE HYPOCOTYLS 6, Protein of unknown function (DUF640) (.1) Lus10038424 [exp] 198 / 8e-65 AT1G07090 247 / 9e-84 LIGHT SENSITIVE HYPOCOTYLS 6, Protein of unknown function (DUF640) (.1) Lus10042565 [exp] 196 / 3e-64 AT5G28490 233 / 1e-78 ORGAN BOUNDARY 2, LIGHT-DEPENDENT SHORT HYPOCOTYLS 1, Protein of unknown function (DUF640) (.1) Lus10022918 [exp] 187 / 2e-60 AT2G31160 249 / 4e-84 ORGAN BOUNDARY 1, LIGHT SENSITIVE HYPOCOTYLS 3, Protein of unknown function (DUF640) (.1) Lus10024901 [exp] 187 / 3e-60 AT2G31160 249 / 3e-84 ORGAN BOUNDARY 1, LIGHT SENSITIVE HYPOCOTYLS 3, Protein of unknown function (DUF640) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04852 [poplar] [flax] DUF640 Protein of unknown function (DUF640)
Representative CDS sequence Show only first row Show all	>Potri.011G109900.3 pacid=42781855 polypeptide=Potri.011G109900.3.p locus=Potri.011G109900 ID=Potri.011G109900.3.v4.1 annot-version=v4.1 ATGTCAAGCAACAAAGGGAAAGACATAGCAGAAGGTTCATCAAGAGGTGGCGCTAATGCTCCTGACCAGCAAAGTCCACCTCCTTTGAGTCGATACGAGT CGCAGAAAAGGCGCGATTGGAACACTTTTGGTCAGTACTTGAGGAACCAGAGGCCCCCAGTTGCATTATCACAGTGTAACGCAAACCAAGTGCTTGATTT TCTTCGATACCTCGATCAATTTGGCAAGACTAAGGTGCACTTACAAGGGTGTGTCTTTTTTGGACAGCCTGAGCCACCAGGGCCTTGTACTTGCCCACTT AAGCAAGCCTGGGGTAGCCTTGATGCTCTCATCGGCCGGCTTAGGGCTGCTTATGAAGAAAACGGTGGCTTGCCTGAGACAAACCCTTTTGCAAGTGGTG CTATTAGAGTATATCTACGAGAAGTGAGGGACTCTCAAGCCAAGGCAAGAGGAATTCCTTATAAGAAGAAGAAGAAGAAGAGGAATCCGACGAAAGCTAA CGATGAGAGCTCAAGCTTTCATATGCAGTAA
AA sequence Show only first row Show all	>Potri.011G109900.3 pacid=42781855 polypeptide=Potri.011G109900.3.p locus=Potri.011G109900 ID=Potri.011G109900.3.v4.1 annot-version=v4.1 MSSNKGKDIAEGSSRGGANAPDQQSPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANQVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPL KQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARGIPYKKKKKKRNPTKANDESSSFHMQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Potri.011G109900 [exp]	0	1
AT2G31940			unknown protein		Potri.009G024500 [exp]	1.00	0.8445
AT2G44930			Plant protein of unknown funct...		Potri.017G019700 [exp]	1.41	0.8395
AT1G05760		RTM1	restricted tev movement 1, Man...		Potri.010G144900 [exp]	5.74	0.8059	Pt-RTM1.1
AT2G19090			Protein of unknown function (D...		Potri.006G077000 [exp]	8.24	0.7936
AT4G14103			F-box/RNI-like superfamily pro...		Potri.001G395000 [exp]	13.22	0.7703
AT5G13190		AtGILP	GSH-induced LITAF domain prote...		Potri.001G061900 [exp]	15.23	0.7701
AT3G01960			unknown protein		Potri.017G065916 [exp]	17.00	0.7495
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G116210 [exp]	17.17	0.7836
AT1G05460		SDE3	SILENCING DEFECTIVE, P-loop co...		Potri.005G047500 [exp]	19.49	0.7467
AT5G18790			Ribosomal protein L33 family p...		Potri.001G396700 [exp]	20.66	0.7033

Compare expression of checked genes

Potri.011G109900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.