Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 138 / 6e-42 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 129 / 1e-38 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 108 / 2e-30 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 87 / 7e-22 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 84 / 5e-21 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 53 / 5e-09 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 45 / 3e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G28290 42 / 8e-05 AGP31 arabinogalactan protein 31 (.1.2) AT5G41050 40 / 0.0002 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G392400 [exp] 280 / 3e-98 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 129 / 2e-38 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 126 / 1e-37 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 122 / 9e-36 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 120 / 2e-35 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 47 / 5e-07 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 48 / 7e-07 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 45 / 6e-06 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 42 / 6e-05 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028134 [exp] 173 / 1e-55 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 171 / 5e-55 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 170 / 1e-54 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 170 / 2e-54 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 169 / 3e-54 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 144 / 3e-44 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 146 / 3e-42 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10042201 [exp] 121 / 2e-35 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 120 / 7e-35 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 108 / 1e-30 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [poplar] [flax] Transthyretin PF01190 [poplar] [flax] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Potri.011G111300.1 pacid=42781560 polypeptide=Potri.011G111300.1.p locus=Potri.011G111300 ID=Potri.011G111300.1.v4.1 annot-version=v4.1 ATGGCAAAGTGTTTCACCGTTGCTGCCTTCGTTGCTACAGCTCTCTGCTTCTCCTCCGTTCTCATCTCCGCCTATGCTGCAGATTACTTAGATGTCGAAG GCAAGGTTTACTGTGACACTTGCCGGGTTGAGTTTCAGACCAAGATCAGCGACGCCATTCCAGGTGCCAAGGTGAAGCTGGTATGCAACAACCGTGAGAA TGGCACATTGACATATACCGTGGAGGGCACAACTGACAGCAGTGGCACATACCGCCTACCTGTGGTGGGAGATCACGAGGAAGATATCTGTGAGGTTAGG TTGGTGGAGAGCCCCAGAGCCGATTGCAATGAACCATTCAAGAGCGTTGATTCTGCTAGGATCCTCCTCACCAAGAACGTTGGAGTGGTGGATAATCTCC GATATGCCAATGCTCTTGGGTACATGAAGAAGGTGGCTCAACCAGAATGTGCAAAAGTACTCGAAGAAATGGGTTTCCTTCCTGTTGAGGCGTAA
AA sequence Show only first row Show all	>Potri.011G111300.1 pacid=42781560 polypeptide=Potri.011G111300.1.p locus=Potri.011G111300 ID=Potri.011G111300.1.v4.1 annot-version=v4.1 MAKCFTVAAFVATALCFSSVLISAYAADYLDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGTLTYTVEGTTDSSGTYRLPVVGDHEEDICEVR LVESPRADCNEPFKSVDSARILLTKNVGVVDNLRYANALGYMKKVAQPECAKVLEEMGFLPVEA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29140			Pollen Ole e 1 allergen and ex...		Potri.011G111300 [exp]	0	1
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.010G096000 [exp]	1.00	0.9987
AT3G04080		ATAPY1	apyrase 1 (.1)		Potri.019G031200 [exp]	1.41	0.9985	Pt-APY1.2
AT1G65880		BZO1	benzoyloxyglucosinolate 1 (.1)		Potri.017G138451 [exp]	2.44	0.9983
AT5G01870			Bifunctional inhibitor/lipid-t...		Potri.016G136000 [exp]	4.89	0.9944	Pt-LTP2.2
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Potri.013G051000 [exp]	4.89	0.9975
AT2G30220			GDSL-like Lipase/Acylhydrolase...		Potri.013G153000 [exp]	5.19	0.9938
AT3G15850		JB67, FADB, ADS...	FATTY ACID DESATURASE B, fatty...		Potri.011G152100 [exp]	5.91	0.9946
AT2G40475		ASG8	ALTERED SEED GERMINATION 8, un...		Potri.013G083101 [exp]	9.16	0.9821
AT4G24340			Phosphorylase superfamily prot...		Potri.013G081233 [exp]	10.48	0.9937
AT1G69560	MYB	LOF2, ATMYB105	LATERAL ORGAN FUSION 2, myb do...		Potri.017G085200 [exp]	10.48	0.9863

Compare expression of checked genes

Potri.011G111300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.