Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78870 311 / 8e-111 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) AT1G16890 310 / 1e-110 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) AT3G08690 154 / 5e-49 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G41700 154 / 6e-49 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT1G64230 154 / 6e-49 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT4G27960 153 / 2e-48 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT5G53300 153 / 2e-48 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT2G16740 152 / 5e-48 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 149 / 5e-47 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT3G08700 139 / 9e-43 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G392500 [exp] 312 / 4e-111 AT1G78870 310 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.019G131400 [exp] 154 / 9e-49 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.016G138900 [exp] 154 / 1e-48 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G168200 [exp] 153 / 2e-48 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.003G136200 [exp] 152 / 3e-48 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 152 / 4e-48 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.001G094900 [exp] 152 / 6e-48 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G471200 [exp] 150 / 2e-47 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.015G023300 [exp] 150 / 2e-47 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017654 [exp] 308 / 2e-109 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10033611 [exp] 308 / 2e-109 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10000353 [exp] 310 / 2e-102 AT1G16890 313 / 3e-103 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10000615 [exp] 284 / 2e-94 AT1G16890 286 / 9e-95 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10021385 [exp] 153 / 3e-48 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 152 / 5e-48 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 152 / 5e-48 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 151 / 1e-47 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 151 / 1e-47 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10032352 [exp] 151 / 1e-47 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.011G111400.2 pacid=42781738 polypeptide=Potri.011G111400.2.p locus=Potri.011G111400 ID=Potri.011G111400.2.v4.1 annot-version=v4.1 ATGGCCAGCAGTAATCTCCCTCGTAGAATCATCAAGGAAACTCAACGTCTCCTCAGTGAACCAGCTCCAGGAATTAGTGCTTCCCCATCGGAGGATAATA TGCGATATTTTAATGTCATGATTCTTGGCCCAACACAATCTCCGTATGAAGGAGGGGTTTTCAAGCTGGAATTATTTCTGCCTGAAGAATATCCAATGGC TGCGCCTAAGGTTCGATTTCTGACCAAAATATACCATCCTAACATCGATAAGCTTGGAAGGATATGCCTTGACATTCTGAAAGACAAATGGAGTCCTGCT CTTCAGATACGAACTGTGCTTTTGAGCATCCAAGCACTTCTTAGTGCTCCAAACCCTGATGATCCACTTTCTGAGAACATCGCAAAGCATTGGAAAACGA ATGAAGCAGAAGCTGTTGAGACAGCTAAGGAGTGGACCCGTTTATATGCAAGTGGTGCATGA
AA sequence Show only first row Show all	>Potri.011G111400.2 pacid=42781738 polypeptide=Potri.011G111400.2.p locus=Potri.011G111400 ID=Potri.011G111400.2.v4.1 annot-version=v4.1 MASSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPA LQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78870		UBC35 ,UBC13A	UBIQUITIN CONJUGATING ENZYME 1...		Potri.011G111400 [exp]	0	1
AT2G27020		PAG1	20S proteasome alpha subunit G...		Potri.009G020800 [exp]	2.00	0.9397	PAG1.2
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.005G007300 [exp]	4.35	0.9123
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Potri.009G031200 [exp]	5.47	0.9370
AT3G42050			vacuolar ATP synthase subunit ...		Potri.013G078700 [exp]	5.65	0.9282
AT1G09150			pseudouridine synthase and arc...		Potri.005G023600 [exp]	7.07	0.9280
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Potri.010G069600 [exp]	8.48	0.9066
AT5G09900		RPN5A, MSA, EMB...	REGULATORY PARTICLE NON-ATPASE...		Potri.007G076900 [exp]	8.77	0.9169
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Potri.001G222200 [exp]	9.16	0.9238	Pt-ACCAL.3
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Potri.010G141900 [exp]	10.39	0.9285	Pt-SAR1.2
AT1G30890			Integral membrane HRF1 family ...		Potri.017G028425 [exp]	13.19	0.8887

Compare expression of checked genes

Potri.011G111400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.