Potri.011G114700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 44 / 2e-05 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G12880 39 / 0.0007 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G15750 39 / 0.0008 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G209800 44 / 2e-05 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.007G108301 40 / 0.0003 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.007G068300 39 / 0.0007 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038738 41 / 0.0002 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10002738 39 / 0.0009 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10038737 39 / 0.0009 AT5G64620 56 / 7e-10 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.011G114700.1 pacid=42782159 polypeptide=Potri.011G114700.1.p locus=Potri.011G114700 ID=Potri.011G114700.1.v4.1 annot-version=v4.1
ATGGAGTCCTGCAGTCTTCTAGTTCTCTCTCTCTCCCTCTTAACCTTGTCTTATCAGTTTCTGGCCATAAAATCTGATGAGGCTTTGATCCAAAACCTAT
GTCACAAAACACCAGAACCAGTCCTTTGCGCAGATTGCCTCCATGGTGATCCTAGCGGCAAGGCTGCAGATGCTAGGAGAGTAGCACTGATAACAGTGCG
CTGTGCCGAATACGATGCCGAACAAGTATATAATTTCACGTTCAACCTCTGGCAGAACACTCCCAAATCAAATGCTGCACTGTACAACATCCTTGACACA
TGTTCAAGCCAGTTTCTCGTGGCACATGATAGTTTTCGCGGCGCCACGGTTGCCCTTGAAGATCAGGGGTGGCGTAATTGGCGTGGGACGGCCATTTATG
AATTAACCACTCAAGTCACTCCTTACCTGAACCGCTGCCTGGACCTCTTCAAAAAGCAACCGCAGCTTCCATTGCCAAACACTATCTTGGTCGGGACTAA
TGCTGTCAACCAAGGCATTGCAATTAGCTTGGGGATTTTGAAGAATATTCCTGATAAGTTAACCCGCTCATAA
AA sequence
>Potri.011G114700.1 pacid=42782159 polypeptide=Potri.011G114700.1.p locus=Potri.011G114700 ID=Potri.011G114700.1.v4.1 annot-version=v4.1
MESCSLLVLSLSLLTLSYQFLAIKSDEALIQNLCHKTPEPVLCADCLHGDPSGKAADARRVALITVRCAEYDAEQVYNFTFNLWQNTPKSNAALYNILDT
CSSQFLVAHDSFRGATVALEDQGWRNWRGTAIYELTTQVTPYLNRCLDLFKKQPQLPLPNTILVGTNAVNQGIAISLGILKNIPDKLTRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Potri.011G114700 0 1
AT5G37930 Protein with RING/U-box and TR... Potri.004G091900 1.00 0.6500
AT1G74220 unknown protein Potri.012G061700 5.47 0.5331
Potri.018G031250 34.85 0.4072
AT3G15370 ATHEXPALPHA1.24... expansin 12 (.1) Potri.001G401700 46.04 0.4562
AT2G28420 GLYI8 glyoxylase I 8, Lactoylglutath... Potri.009G055500 50.24 0.4107
AT1G79860 ATROPGEF12, ROP... MATERNAL EFFECT EMBRYO ARREST ... Potri.003G052600 54.77 0.4505
AT4G34770 SAUR-like auxin-responsive pro... Potri.009G127400 62.83 0.3862
AT4G22300 SOBER1 SUPPRESSOR OF AVRBST-ELICITED ... Potri.004G001701 65.17 0.4114
AT1G57775 Protein of unknown function (D... Potri.004G115201 79.30 0.3532
AT4G14965 ATMAPR4 membrane-associated progestero... Potri.006G023801 84.49 0.4054

Potri.011G114700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.