Potri.011G114800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G33845 215 / 2e-72 Nucleic acid-binding, OB-fold-like protein (.1)
AT1G23750 196 / 3e-65 Nucleic acid-binding, OB-fold-like protein (.1)
AT4G28440 189 / 2e-62 Nucleic acid-binding, OB-fold-like protein (.1)
AT1G10590 182 / 8e-60 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
AT1G03810 174 / 1e-56 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G396100 236 / 2e-81 AT1G23750 194 / 5e-65 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.010G041000 218 / 2e-74 AT1G23750 234 / 1e-80 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.008G189900 215 / 6e-73 AT1G23750 239 / 9e-83 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.007G137600 195 / 6e-65 AT4G28440 193 / 2e-64 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.017G014400 190 / 6e-63 AT4G28440 194 / 9e-65 Nucleic acid-binding, OB-fold-like protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030617 204 / 2e-68 AT1G23750 229 / 7e-79 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10030871 202 / 5e-68 AT1G23750 226 / 2e-77 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10015411 198 / 7e-66 AT2G33845 186 / 4e-61 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10013989 195 / 1e-64 AT4G28440 186 / 3e-61 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10002172 187 / 7e-62 AT2G33845 189 / 1e-62 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10029155 187 / 1e-61 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10013010 186 / 2e-61 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10039889 182 / 9e-60 AT2G33845 185 / 1e-60 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Representative CDS sequence
>Potri.011G114800.1 pacid=42781866 polypeptide=Potri.011G114800.1.p locus=Potri.011G114800 ID=Potri.011G114800.1.v4.1 annot-version=v4.1
ATGGCGACACAAACACCGATTGAGCAACAGGAGAGTAGCAGTGCCAGTGCGAGTGCGGGTGCAAAACCGGGACTTAGAAAGCCTGTGTTCATCAAAGTGG
ACCAGCTTAAGCCTGGAACTGGAGGCCACACATTGACTGTCAAGGTCCTTAATTTCAATACTGTCCCTCAAAAGGACCGCCGATCGGTCTCTCTGCATGT
CCGTCAGACACGAATAGCTGAGTGTCTTATTGGGGACGAGACTGGTACCATCATTTTCACCGCAAGAAACGATCAAGTTGATCTGATGAAGCCAGGGACA
ACTGTTATTCTCCGCAATGCAAAGATTGACATGTTTAAGGGGTCTATGAGGCTAGCAGTTGACAAATGGGGTCGTGTTGAAGTCACTGAGCCTGCAGAAT
TTGTAGTCAAGGAAGACAACAATCTCTCTCTTGTTGAATATGAGCTTGTGAATGTTGCAGAAGAGTGA
AA sequence
>Potri.011G114800.1 pacid=42781866 polypeptide=Potri.011G114800.1.p locus=Potri.011G114800 ID=Potri.011G114800.1.v4.1 annot-version=v4.1
MATQTPIEQQESSSASASAGAKPGLRKPVFIKVDQLKPGTGGHTLTVKVLNFNTVPQKDRRSVSLHVRQTRIAECLIGDETGTIIFTARNDQVDLMKPGT
TVILRNAKIDMFKGSMRLAVDKWGRVEVTEPAEFVVKEDNNLSLVEYELVNVAEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G33845 Nucleic acid-binding, OB-fold-... Potri.011G114800 0 1
AT5G12330 LRP1 LATERAL ROOT PRIMORDIUM 1, Lat... Potri.001G027700 2.44 0.7611
AT5G58320 Kinase interacting (KIP1-like)... Potri.019G061600 3.60 0.8038
AT4G26490 Late embryogenesis abundant (L... Potri.011G165500 4.89 0.7970
AT1G79760 DTA4 downstream target of AGL15-4 (... Potri.011G047800 6.63 0.7737 DTA4.2
AT3G44716 unknown protein Potri.009G148200 8.06 0.7704
AT4G18930 RNA ligase/cyclic nucleotide p... Potri.011G075600 12.12 0.7314
AT2G38720 MAP65-5 microtubule-associated protein... Potri.003G192400 17.05 0.7757
AT5G55540 LOP1, TRN1 LOPPED 1, tornado 1 (.1) Potri.001G361200 21.44 0.7316
AT2G40815 Calcium-dependent lipid-bindin... Potri.019G065500 22.29 0.7595
AT3G10980 SAG20, WI12, AT... PLAC8 family protein (.1) Potri.016G129700 23.45 0.7031

Potri.011G114800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.