Potri.011G117001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53880 45 / 1e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G398700 50 / 1e-10 AT5G53880 45 / 2e-08 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000796 47 / 2e-09 AT5G53880 50 / 4e-10 unknown protein
PFAM info
Representative CDS sequence
>Potri.011G117001.1 pacid=42782003 polypeptide=Potri.011G117001.1.p locus=Potri.011G117001 ID=Potri.011G117001.1.v4.1 annot-version=v4.1
ATGAAGTTCTTGTTCCAGTGCCCTTGTTGCTCATGTTTCTGCTTCATGAAGCCTAAACAGGGAAGACCAAAGGTGAAGGAAACTACCAAGGAAGCGAAGA
AAGAGTGA
AA sequence
>Potri.011G117001.1 pacid=42782003 polypeptide=Potri.011G117001.1.p locus=Potri.011G117001 ID=Potri.011G117001.1.v4.1 annot-version=v4.1
MKFLFQCPCCSCFCFMKPKQGRPKVKETTKEAKKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G53880 unknown protein Potri.011G117001 0 1
AT5G53200 MYB TRY TRIPTYCHON, Homeodomain-like s... Potri.015G022000 1.41 0.8908 MYB179
AT4G09460 MYB ATMYB6, ATMYB8 myb domain protein 6 (.1) Potri.017G128900 4.89 0.8269 Pt-MYB.42,MYB181
AT5G23280 TCP TCP7 TCP family transcription facto... Potri.007G074028 7.14 0.8200
AT3G19850 Phototropic-responsive NPH3 fa... Potri.008G085500 8.00 0.8175
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Potri.015G143700 9.00 0.7739
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Potri.006G207400 9.94 0.7318 ILL1,Pt-ILR1.2
AT3G60220 ATL4 TOXICOS EN LEVADURA 4 (.1) Potri.014G053600 10.63 0.7275 ATL4.2
AT3G03620 MATE efflux family protein (.1... Potri.013G069400 12.96 0.8001
AT5G41315 bHLH MYC6.2, GL3 GLABROUS 3, GLABRA 3, basic he... Potri.002G159400 14.07 0.8083 Pt-TAN1.2
AT5G18290 SIP1B, SIP1;2 SMALL AND BASIC INTRINSIC PROT... Potri.002G227500 17.66 0.7744

Potri.011G117001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.