Potri.011G118200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28280 184 / 7e-58 VQ motif-containing protein (.1.2)
AT3G15300 177 / 2e-55 VQ motif-containing protein (.1)
AT5G53830 170 / 2e-52 VQ motif-containing protein (.1)
AT2G33780 120 / 7e-34 VQ motif-containing protein (.1)
AT1G80450 63 / 4e-12 VQ motif-containing protein (.1)
AT5G08480 57 / 4e-10 VQ motif-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G399100 390 / 2e-139 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.011G053700 191 / 2e-60 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Potri.004G044800 179 / 1e-55 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.004G134200 72 / 2e-15 AT5G08480 150 / 1e-46 VQ motif-containing protein (.1.2)
Potri.006G266700 71 / 7e-15 AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
Potri.018G016500 70 / 2e-14 AT1G80450 67 / 6e-14 VQ motif-containing protein (.1)
Potri.006G266600 69 / 2e-14 AT1G80450 61 / 6e-12 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041929 153 / 6e-46 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
Lus10005543 151 / 4e-45 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
Lus10015315 142 / 2e-41 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10025443 102 / 4e-27 AT1G28280 154 / 2e-47 VQ motif-containing protein (.1.2)
Lus10026247 85 / 6e-20 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10042423 82 / 9e-19 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10020092 65 / 2e-12 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
Lus10026897 44 / 3e-05 AT1G80450 67 / 4e-14 VQ motif-containing protein (.1)
PFAM info
Representative CDS sequence
>Potri.011G118200.4 pacid=42781355 polypeptide=Potri.011G118200.4.p locus=Potri.011G118200 ID=Potri.011G118200.4.v4.1 annot-version=v4.1
ATGGAAACCTCAGCAAGATTTCAAGAAACCAGAAACCCATCTCCAATAAACTCGCCTCATGGCAATGGAAGCAACAATGGGGTCCAAGTTCACACCTCAA
CAGTCACTCCAATACCCATCTCCAGATCTGACACTAACCCTTACCCAACAACCTTTGTCCAAGCAGACACTTCTACTTTCAAACAAGTTGTCCAGATGCT
CACTGGCTCAACAGAGACAGCAAAACAGGCTTCCTCGAAGACAACCCAAGATCCACCAACAACACCGACTCAAACTTCAAGAAACTACGCCATCCCTCCT
ATCAAGAACATGCCGGCCAAGAGACAACAAAACAGCTTCAAACTTTATGAAAGAAGAAACAACAGCTTCAAAAACAGTCTCATGATCAACACTCTATTGC
CTAGTTTTGCAAACAGTAGTAACGCTTCCCCAGTTACCGGGTTTTCGCCAAGAAACAAACCAGAGATCTTGTCTCCAAGCTTGCTTGACTTCCCTAAACT
TACACTTAGCCCTGTAACCCCATTAAATGAAGATCCTTTTAACAAGTGCTCACCTTCTTTAGGGAATTCATCATCAGAAGAGGAGAGAGCAATAGCAGAG
AAAGGTTTTTATTTGCATCCGTCGCCTATCTCTACCCCTAGAGATTCAGAGCCCCAGTTGCTGTCGCTTTTTCCTGTAACCTCACCGAAAGTCTCAGGCT
CTTCTTCATGA
AA sequence
>Potri.011G118200.4 pacid=42781355 polypeptide=Potri.011G118200.4.p locus=Potri.011G118200 ID=Potri.011G118200.4.v4.1 annot-version=v4.1
METSARFQETRNPSPINSPHGNGSNNGVQVHTSTVTPIPISRSDTNPYPTTFVQADTSTFKQVVQMLTGSTETAKQASSKTTQDPPTTPTQTSRNYAIPP
IKNMPAKRQQNSFKLYERRNNSFKNSLMINTLLPSFANSSNASPVTGFSPRNKPEILSPSLLDFPKLTLSPVTPLNEDPFNKCSPSLGNSSSEEERAIAE
KGFYLHPSPISTPRDSEPQLLSLFPVTSPKVSGSSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28280 VQ motif-containing protein (.... Potri.011G118200 0 1
AT1G27752 Ubiquitin system component Cue... Potri.014G016900 2.44 0.8209
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.009G012100 9.16 0.8463 PtrFLA14-9,FLA14.9
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Potri.019G121200 12.24 0.8438 FLA14.11
AT4G36870 HD BLH2, SAW1 SAWTOOTH 1, BEL1-like homeodom... Potri.005G129500 15.49 0.7276
AT3G54970 D-aminoacid aminotransferase-l... Potri.010G216500 20.97 0.6585
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.019G123200 21.79 0.8216 FLA14.13
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.013G151500 24.39 0.8194 Pt-FLA14.15
AT3G19280 FUCTA, FUCT1, A... fucosyltransferase 11 (.1) Potri.009G101500 28.30 0.8109 FUCT3.2
AT3G54870 AtKINUc, CAE1, ... MORPHOGENESIS OF ROOT HAIR 2, ... Potri.010G227000 29.59 0.8074
AT5G15630 IRX6, COBL4 IRREGULAR XYLEM 6, COBRA-LIKE4... Potri.004G117200 31.24 0.8182

Potri.011G118200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.