Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53130 136 / 1e-41 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1) AT5G55110 80 / 2e-19 Stigma-specific Stig1 family protein (.1) AT1G50720 70 / 1e-15 Stigma-specific Stig1 family protein (.1) AT4G26880 69 / 4e-15 Stigma-specific Stig1 family protein (.1) AT1G50650 69 / 5e-15 Stigma-specific Stig1 family protein (.1) AT1G11925 63 / 3e-13 Stigma-specific Stig1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G399200 [exp] 197 / 1e-65 AT1G53130 149 / 2e-46 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Potri.004G007100 [exp] 85 / 1e-21 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007200 [exp] 82 / 7e-20 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.004G006900 [exp] 79 / 3e-19 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1) Potri.011G008932 [exp] 79 / 4e-19 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1) Potri.004G007000 [exp] 78 / 6e-19 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.011G008804 [exp] 78 / 8e-19 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1) Potri.011G009000 [exp] 78 / 8e-19 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.011G009100 [exp] 74 / 2e-17 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041930 [exp] 120 / 1e-35 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10005544 [exp] 116 / 2e-34 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10043047 [exp] 65 / 1e-13 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1) Lus10011146 [exp] 64 / 2e-13 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Lus10006512 [exp] 63 / 3e-13 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1) Lus10020831 [exp] 63 / 6e-13 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1) Lus10012679 [exp] 62 / 1e-12 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1) Lus10000696 [exp] 62 / 2e-12 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1) Lus10011117 [exp] 60 / 1e-11 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04885 [poplar] [flax] Stig1 Stigma-specific protein, Stig1
Representative CDS sequence Show only first row Show all	>Potri.011G118600.1 pacid=42781622 polypeptide=Potri.011G118600.1.p locus=Potri.011G118600 ID=Potri.011G118600.1.v4.1 annot-version=v4.1 ATGGCCAGTTCTCTACTCAAACTTGCAACCATTCTCTCCCTGGTCGTTTCCATACTCCTAGCCTTGCACACTCAAATAACCTTATCGGTCGATGTAGAAG ATGAAGATGAAGAGTATGTTCTTGACACCCCACCAGTCAATTTCAGATCAAGAAGCCGGTTCTTGGCCACTGTCATAAAGAAAGGTACACGATGTAACGC TGAGCGATATAACAAATGTAATGGCGTTTCGGCCAACAAAGGCACGGGCCTGCTTTACTGTTGCAAGAAACATTGCCGCAATGTTCTTGGAGACGAGAAC AACTGTGGACAATGTGGTAACAAGTGCAAGCTTGGAGAGTCTTGCTGCAATGGAAAATGTACAAACGTCATTTACAACGCCAGTAATTGTGGAAAATGCA ACAATAAGTGTTCCCCTGGGGTTAAATGTCAATATGGAACATGTGGGTATGCTTAA
AA sequence Show only first row Show all	>Potri.011G118600.1 pacid=42781622 polypeptide=Potri.011G118600.1.p locus=Potri.011G118600 ID=Potri.011G118600.1.v4.1 annot-version=v4.1 MASSLLKLATILSLVVSILLALHTQITLSVDVEDEDEEYVLDTPPVNFRSRSRFLATVIKKGTRCNAERYNKCNGVSANKGTGLLYCCKKHCRNVLGDEN NCGQCGNKCKLGESCCNGKCTNVIYNASNCGKCNNKCSPGVKCQYGTCGYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53130		GRI	GRIM REAPER, Stigma-specific S...		Potri.011G118600 [exp]	0	1
AT3G10720			Plant invertase/pectin methyle...		Potri.008G011100 [exp]	1.41	0.9823
AT3G05220			Heavy metal transport/detoxifi...		Potri.005G120200 [exp]	2.82	0.9683
AT4G37160		SKS15	SKU5 similar 15 (.1)		Potri.007G038200 [exp]	3.00	0.9665
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Potri.015G143400 [exp]	4.47	0.9650
AT3G54220	GRAS	SGR1, SCR	SHOOT GRAVITROPISM 1, SCARECRO...		Potri.005G226800 [exp]	6.48	0.9547
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.011G028100 [exp]	7.07	0.9508
AT4G35220			Cyclase family protein (.1)		Potri.001G301700 [exp]	8.94	0.9530
					Potri.019G016110 [exp]	9.21	0.9564
AT2G45220			Plant invertase/pectin methyle...		Potri.015G127700 [exp]	9.53	0.9545	Pt-PME.5
AT3G55470			Calcium-dependent lipid-bindin...		Potri.010G203100 [exp]	9.89	0.9426

Compare expression of checked genes

Potri.011G118600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.