Plant FIBer expression Database

Potri.011G118900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15353 70 / 5e-18 ATMT3, MT3 metallothionein 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G400100
[exp]
89 / 2e-25 AT3G15353 65 / 5e-16 metallothionein 3 (.1.2)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.011G118900.2 pacid=42781014 polypeptide=Potri.011G118900.2.p locus=Potri.011G118900 ID=Potri.011G118900.2.v4.1 annot-version=v4.1
ATGTCTAGCACCTGCGACAACTGCGACTGCGCTGACAAGACCCAGTGTGTCAAGAAGGGAAGCAGCTACACTGCTGACATCGTTGAGACTGAGAAGAGCC
ATGTCTACACTGGAGTCATGGAGGTTCCAGCAACCGAGAACGATGGCAAGTGCAAGTGCGGCGCTAACTGCACTTGCACTACCTGCACATGCGGTCATTA
A
AA sequence
>Potri.011G118900.2 pacid=42781014 polypeptide=Potri.011G118900.2.p locus=Potri.011G118900 ID=Potri.011G118900.2.v4.1 annot-version=v4.1
MSSTCDNCDCADKTQCVKKGSSYTADIVETEKSHVYTGVMEVPATENDGKCKCGANCTCTTCTCGH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15353 ATMT3, MT3 metallothionein 3 (.1.2) Potri.011G118900
[exp]
0 1
AT1G08230 ATGAT1 L-GAMMA-AMINOBUTYRIC ACID TRAN... Potri.008G026600
[exp]
4.47 0.8494
Potri.014G179200
[exp]
14.31 0.8642
AT3G18840 Tetratricopeptide repeat (TPR)... Potri.004G151500
[exp]
19.05 0.8101
Potri.001G400200
[exp]
21.44 0.8414
AT5G50915 bHLH bHLH137 basic helix-loop-helix (bHLH) ... Potri.012G104900
[exp]
23.66 0.8347
AT1G06510 unknown protein Potri.005G203100
[exp]
24.89 0.8427
AT5G54250 HLM1, DND2, ATC... DEFENSE, NO DEATH 2, cyclic nu... Potri.001G407800
[exp]
25.09 0.8394
AT5G02570 Histone superfamily protein (.... Potri.004G091200
[exp]
27.16 0.7751
AT2G43400 ETFQO electron-transfer flavoprotein... Potri.017G027500
[exp]
30.46 0.8123
AT5G05690 CBB3, DWF3, CYP... DWARF 3, CYTOCHROME P450 90A1,... Potri.008G067500
[exp]
30.62 0.8220

Potri.011G118900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.